@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : E7EPG8_HUMAN: (2017-06-02 )
WFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVKHYLILPSEEEGRLYFSMDDGQTRFTDLLQLVEFH

Atome Classification :

(24 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACE_B_3(1CSZ)

[Raw transfer]




ACE_B_3(1LKK)
LCK_HUMAN
[Raw transfer]




MLA_D_21(5EEL)
GRB7_HUMAN
[Raw transfer]




MLA_E_24(5EEL)
GRB7_HUMAN
[Raw transfer]




MLA_C_18(5EEL)
GRB7_HUMAN
[Raw transfer]




MLA_A_13(5EEL)
GRB7_HUMAN
[Raw transfer]




MLA_A_3(4WWQ)
GRB7_HUMAN
[Raw transfer]




CHAIN_L_5(3PQZ)

[Raw transfer]

-

CHAIN_M_6(3PQZ)
GRB7_HUMAN
[Raw transfer]

-

CHAIN_B_2(1MW4)

[Raw transfer]

-

CHAIN_M_6(3PQZ)
GRB7_HUMAN
[Raw transfer]

-

CHAIN_M_6(3PQZ)
GRB7_HUMAN
[Raw transfer]

-

CHAIN_M_6(3PQZ)
GRB7_HUMAN
[Raw transfer]

-

CHAIN_B_2(2L4K)

[Raw transfer]

-

6 PsiBlast_PDB 97.35100%-189 - C3 -5D0J Calc... GRB7_HUMAN
230 HHSearch 96.05100%-198 - C3 -3PQZ 2.0 GRB7_HUMAN
1 PsiBlast_PDB 96.05100%-198 - C3 -3PQZ 2.0 GRB7_HUMAN
26 PsiBlast_CBE 95.44100%-183 - C3 -5EEL 3.5 GRB7_HUMAN
29 PsiBlast_CBE 95.39100%-186 - C3 -5EEL Calc... GRB7_HUMAN
7 PsiBlast_PDB 94.67100%-188 - C3 -5EEL 3.9 GRB7_HUMAN
3 PsiBlast_PDB 94.67100%-184 - C3 -2QMS Calc... GRB7_HUMAN
8 PsiBlast_PDB 94.35100%-184 - C3 -5EEQ Calc... GRB7_HUMAN
23 PsiBlast_CBE 93.98100%-194 - C3 -3PQZ 7.7 GRB7_HUMAN
5 PsiBlast_PDB 93.96100%-188 - C3 -4WWQ 3.2 GRB7_HUMAN
28 PsiBlast_CBE 93.85100%-187 - C3 -5EEL 4.3 GRB7_HUMAN
9 PsiBlast_PDB 93.25100%-170 - C3 -4X6S Calc... GRB7_HUMAN
22 PsiBlast_CBE 93.24100%-176 - C3 -3PQZ 2.2 GRB7_HUMAN
27 PsiBlast_CBE 93.06100%-179 - C3 -5EEL 3.3 GRB7_HUMAN
21 PsiBlast_CBE 90.85100%-179 - C3 -3PQZ 2.0
229 HHSearch 84.9465%-194 - C3 -2AUG Calc... GRB14_HUMAN
12 PsiBlast_PDB 84.7264%-194 - C3 -2AUG - GRB14_HUMAN -
232 HHSearch 84.3767%-205 - C3 -1NRV Calc... GRB10_HUMAN
11 PsiBlast_PDB 84.3767%-205 - C3 -1NRV - GRB10_HUMAN -
10 PsiBlast_PDB 75.4867% - - C3 -3M7F Calc... GRB10_MOUSE
2 PsiBlast_PDB 75.24100%-111 - C3 -1MW4 3.1
4 PsiBlast_PDB 72.28100% -89 - C3 -2L4K 10.4
247 HHSearch 65.7735% -51 - C3 -1LKK Error LCK_HUMAN
253 Fugue 53.3741% 76 - C3 -1CSZ Error