@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : O00428_HUMAN: (2017-06-02 )
WFHGIPPWRSSRIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQKIKNFQILPCEDDGQTFFSLDDGNTKFSDLIQLVDFY

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

MLA_D_21(5EEL)
GRB7_HUMAN
[Raw transfer]




MLA_C_18(5EEL)
GRB7_HUMAN
[Raw transfer]




MLA_E_24(5EEL)
GRB7_HUMAN
[Raw transfer]




MLA_A_13(5EEL)
GRB7_HUMAN
[Raw transfer]




CHAIN_M_6(3PQZ)
GRB7_HUMAN
[Raw transfer]

-

FMT_E_25(5EEL)
GRB7_HUMAN
[Raw transfer]




CHAIN_L_5(3PQZ)

[Raw transfer]

-

FMT_D_22(5EEL)
GRB7_HUMAN
[Raw transfer]




FMT_B_16(5EEL)
GRB7_HUMAN
[Raw transfer]




CHAIN_B_2(1MW4)

[Raw transfer]

-

CHAIN_L_5(3PQZ)
GRB7_HUMAN
[Raw transfer]

-

CHAIN_L_5(3PQZ)
GRB7_HUMAN
[Raw transfer]

-

CHAIN_M_6(3PQZ)
GRB7_HUMAN
[Raw transfer]

-

CHAIN_B_2(2L4K)

[Raw transfer]

-

1 PsiBlast_PDB 89.9392% - - C3 -3M7F - GRB10_MOUSE -
2 PsiBlast_PDB 82.5692% -45 - C3 -1NRV - GRB10_HUMAN -
148 HHSearch 80.1093% -51 - C3 -1NRV - GRB10_HUMAN -
3 PsiBlast_PDB 77.1965% -34 - C3 -2AUG - GRB14_HUMAN -
146 HHSearch 76.2165% -41 - C3 -2AUG - GRB14_HUMAN -
27 PsiBlast_CBE 75.4360% -32 - C3 -5EEL 3.5 GRB7_HUMAN
26 PsiBlast_CBE 75.0460% -26 - C3 -5EEL 3.0 GRB7_HUMAN
23 PsiBlast_CBE 74.9660% -35 - C3 -3PQZ 6.5 GRB7_HUMAN
9 PsiBlast_PDB 74.5660% -34 - C3 -5D0J - GRB7_HUMAN -
29 PsiBlast_CBE 74.5360% -31 - C3 -5EEL 2.9 GRB7_HUMAN
6 PsiBlast_PDB 74.1860% -24 - C3 -2QMS - GRB7_HUMAN -
11 PsiBlast_PDB 74.1360% -24 - C3 -5EEQ - GRB7_HUMAN -
10 PsiBlast_PDB 73.9760% -33 - C3 -5EEL 3.2 GRB7_HUMAN
28 PsiBlast_CBE 73.4560% -27 - C3 -5EEL 3.3 GRB7_HUMAN
4 PsiBlast_PDB 73.1560% -33 - C3 -3PQZ 6.6 GRB7_HUMAN
8 PsiBlast_PDB 73.1260% -24 - C3 -4WWQ - GRB7_HUMAN -
12 PsiBlast_PDB 73.1160% -22 - C3 -4X6S - GRB7_HUMAN -
145 HHSearch 72.3860% -37 - C3 -3PQZ 6.6 GRB7_HUMAN
22 PsiBlast_CBE 72.1160% -19 - C3 -3PQZ 2.4 GRB7_HUMAN
21 PsiBlast_CBE 71.6960% -28 - C3 -3PQZ 2.3
5 PsiBlast_PDB 55.3060% -22 - C3 -1MW4 4.5
7 PsiBlast_PDB 54.8660% -31 - C3 -2L4K 5.1