@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : TXK_HUMAN: (2017-06-04 )
WYHRNITRNQAEHLLRQESKEGAFIVRDSRHLGSYTISVFMGARRSTEAAIKHYQIKKNDSGQWYVAERHAFQSIPELIWYH

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACE_B_4(2EU0)

[Raw transfer]



CIT_A_2(3S9K)

[Raw transfer]



GOL_A_3(5DC4)

[Raw transfer]



CHAIN_B_2(2EU0)

[Raw transfer]
-
CHAIN_B_2(2ETZ)

[Raw transfer]
-
1 PsiBlast_PDB 89.08100%-151 - C1 -2DM0 Calc...
184 HHSearch 78.0148%-184 - C1 -2EKX Calc...
13 PsiBlast_PDB 77.7747%-184 - C1 -2EKX - -
7 PsiBlast_PDB 72.0755% -61 - C1 -1LUK Calc...
11 PsiBlast_PDB 71.9255% -75 - C1 -2K7A Calc... ?
8 PsiBlast_PDB 69.6155% -61 - C1 -1LUM Calc...
6 PsiBlast_PDB 68.9455% -48 - C1 -1LUI Calc...
10 PsiBlast_PDB 68.6855% -79 - C1 -2K79 Calc... ?
9 PsiBlast_PDB 68.2855% -55 - C1 -1LUN Calc...
2 PsiBlast_PDB 65.9651%-103 - C1 -2GE9 Calc...
186 HHSearch 64.6233% -95 - C1 -2YSX Calc... SHIP1_HUMAN
4 PsiBlast_PDB 64.3555% -66 - C1 -2ETZ 2.3
5 PsiBlast_PDB 63.3855% -66 - C1 -2EU0 3.0
178 HHSearch 63.2136% -74 - C1 -1OPK Calc... ABL1_MOUSE
117 PsiBlast_CBE 61.4636%-153 - C1 -4K45 - PLCG1_RAT -
187 HHSearch 60.9636% -74 - C1 -5DC4 2.1
149 PsiBlast_CBE 59.0533% -62 - C1 -2FO0 - ABL1_HUMAN -
139 PsiBlast_CBE 58.6533% -75 - C1 -5DC9 - -
176 HHSearch 58.0826% -98 - C1 -1I3Z Calc... SH21B_MOUSE
142 PsiBlast_CBE 57.6133% -78 - C1 -3T04 - -
12 PsiBlast_PDB 56.8455% -70 - C1 -3S9K 2.6