@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : spr0554: (2017-12-24 )
MKKRYLVLTALLALSLAACSQEKTKNEDGETKTEQTAKADGTVGSKSQGAAQKKAEVVNKGDYYSIQGKYDEIIVANKHYPLSKDYNPGENPTAKAELVKLIKAMQEAGFPISDHYSGFRSYETQTKLYQDYVNQDGKEAADRYSARPGYSEHQTGLAFDVIGTDGDLVTEEKAAQWLLDHAADYGFVVRYLKGKEKETGYMAEEWHLRYVGKEAKEIAESGLSLEEYYGFEGGDYVD

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

2D8_A_4(4MUS)
?
[Raw transfer]




GOL_B_6(4NT9)
?
[Raw transfer]




LY0_A_3(4MUQ)
?
[Raw transfer]




DAL_A_8(4OX5)
?
[Raw transfer]




DAL_A_5(4OAK)
?
[Raw transfer]




DAL_A_4(4OAK)
?
[Raw transfer]




29 HHSearch 97.7299% -59 - C5 -4NT9 - ? -
22 PsiBlast_CBE 97.5298% -59 - C5 -4NT9 - ? -
21 PsiBlast_CBE 97.0898% -61 - C5 -4NT9 - ? -
77 Fugue 97.03100% -61 - C5 -4D0Y - ? -
2 PsiBlast_PDB 96.71100% -61 - C5 -4D0Y - ? -
31 HHSearch 96.28100% -62 - C5 -4D0Y - ? -
1 PsiBlast_PDB 95.9698% -53 - C5 -4NT9 2.3 ?
27 PsiBlast_CBE 94.94100% -65 - C5 -4OXD - ? -
4 PsiBlast_PDB 94.7398% -58 - C5 -4OX5 4.1 ?
3 PsiBlast_PDB 93.61100% -55 - C5 -4OXD - ? -
35 HHSearch 61.8230% 28 - C5 -4MUR - ? -
34 HHSearch 60.3330% 35 - C5 -4OAK 2.7 ?
11 PsiBlast_PDB 59.0229% 49 - C5 -4MUR - ? -
10 PsiBlast_PDB 58.3333% 57 - C5 -5HNM - VANY_ENTFA -
13 PsiBlast_PDB 57.5629% 46 - C5 -4MUS 4.6 ?
12 PsiBlast_PDB 57.3229% 54 - C5 -4MUT - ? -
36 HHSearch 57.1334% 53 * C5 *5HNM - VANY_ENTFA -
37 HHSearch 56.4734% 64 - C5 -5HNM - VANY_ENTFA -
14 PsiBlast_PDB 56.3229% 62 - C5 -4OAK 3.2 ?
30 HHSearch 55.9938% 99 - C5 -4OX3 - YODJ_BACSU -