@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : spr1479: (2018-01-13 )
MDMTKIALLSDIHGNTTALEAVLADARQLGVDEYWLLGDILMPGTGRRRILDLLDQLPITARVLGNWEDSLWHGVRKELDSTRPSQRYLLRQCQYVLEEISLEEIEVLHNQPLQIHRQFGDLTVGISHHLPDKNWGRELIHTGKQEEFDRLVTHPPCDIAVYGHIHQQLLRYGTGGQLIVNPGSIGQPFFLDAQLRKDLRAQYMILEFDDKGLVDMDFRRVDYDVAAELQLAKDLRLPYFEVYYESLVNGIHHTHHQEFLRELAQKEGCDRELDDWLKSGND

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

AMP_A_3(3QFO)
?
[Raw transfer]




AMP_B_6(3QFO)
?
[Raw transfer]




39 Fugue 87.60100%-115 - C4 -3QFM - ? -
1 PsiBlast_PDB 87.60100%-115 - C4 -3QFM - ? -
3 PsiBlast_PDB 87.43100%-119 - C4 -3QFO 6.2 ?
17 PsiBlast_CBE 86.98100%-120 - C4 -3QFO 5.9 ?
2 PsiBlast_PDB 85.93100%-122 - C4 -3QFN - ? -
18 HHSearch 83.2199% -63 - C4 -3QFM - ? -
19 HHSearch 82.7899% -68 - C4 -3QFM - ? -
21 HHSearch 50.4728% -69 - C4 -3RQZ - ? -
22 HHSearch 50.4528% -71 - C4 -3RQZ - ? -
4 PsiBlast_PDB 48.6228% -34 - C4 -3RQZ - ? -
40 Fugue 47.1718% -14 - C4 -1NNW - ? -
20 HHSearch 47.0917% -24 - C4 -1NNW - ? -
41 Fugue 43.3816%-133 * C4 *1S3L - P936_METJA -
10 PsiBlast_PDB 42.7143%-213 - C4 -1SU1 - YFCE_ECOLI -
25 HHSearch 41.5524%-107 - C4 -3CK2 - ? -
26 HHSearch 37.7119% -70 - C4 -1S3L - P936_METJA -
30 HHSearch 37.0819% -72 - C4 -2AHD - -
27 HHSearch 34.7319% -23 - C4 -2QJC - ? -
33 HHSearch 32.4425% -38 - C4 -1SU1 - YFCE_ECOLI -
15 PsiBlast_PDB 32.0536%-125 - C4 -2DFJ - APAH_SHIFL -