@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VKK9: (2017-10-27 )
MKHSILISGAAQGIGAEIARVFYQRGYKVGIYDINESLAQNLAQELGPNACAGYLDVSDYSQWQHILKEFTDWAGELNILVNNAGILYSGAFENIDIKSHQRTININVNGVINGCHAALPYLKQASFARVINLSSASAIYRQADLISYSASKFAVRGITEGLDVEWKKYGIRVLDVMPLFVQTAMVNNMDAGSIQNMGVDLTPNDIAQQVLSLVEGFVAQTF

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAI_C_8(4NBU)
?
[Raw transfer]




NAI_A_5(4NBU)
?
[Raw transfer]




NAD_C_7(2HSD)
HSD_STREX
[Raw transfer]




NAD_D_8(2HSD)
HSD_STREX
[Raw transfer]




EDO_A_6(5TS3)
?
[Raw transfer]




EDO_B_16(5TS3)
?
[Raw transfer]




31 PsiBlast_CBE 89.7935% 0 - C- -1GEG - BUDC_KLEPN -
37 PsiBlast_CBE 89.7332% -94 - C1 -2HSD 8.8 HSD_STREX
13 PsiBlast_PDB 88.0432% -91 - C1 -2HSD - HSD_STREX -
39 PsiBlast_CBE 87.6932% -95 - C1 -2HSD - HSD_STREX -
34 PsiBlast_CBE 87.6235% 0 - C- -1GEG - BUDC_KLEPN -
33 PsiBlast_CBE 87.6235% 0 - C- -1GEG - BUDC_KLEPN -
32 PsiBlast_CBE 87.6235% 0 - C- -1GEG - BUDC_KLEPN -
30 PsiBlast_CBE 87.6235% 0 - C- -1GEG - BUDC_KLEPN -
29 PsiBlast_CBE 87.6235% 0 - C- -1GEG - BUDC_KLEPN -
28 PsiBlast_CBE 87.6235% 0 - C- -1GEG - BUDC_KLEPN -
5 PsiBlast_PDB 87.6235% 0 - C- -1GEG - BUDC_KLEPN -
41 PsiBlast_CBE 87.5431% -68 - C1 -4NBW - ? -
43 PsiBlast_CBE 87.1731% -67 - C1 -4NBW - ? -
16 PsiBlast_PDB 86.7730%-101 - C1 -1HDC - HSD_STREX -
1 PsiBlast_PDB 86.2534%-114 - C1 -4NBU 9.2 ?
38 PsiBlast_CBE 85.7732% -96 - C1 -2HSD 8.0 HSD_STREX
40 PsiBlast_CBE 84.5531% -67 - C1 -4NBW - ? -
42 PsiBlast_CBE 84.0131% -65 - C1 -4NBW - ? -
22 PsiBlast_CBE 83.3934%-112 - C1 -4NBU 9.2 ?
23 PsiBlast_CBE 82.9334%-111 - C1 -4NBU - ? -