@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VNZ7: (2017-11-18 )
MSNATKFGKVAVLLGGKSAERAVSLDSGQAVLDALLRSGVQAEAFDPQDRSVTELVNYDRAFIVLHGRGGEDGQIQGVLEWLNIPYTGTGVQGSAIGMDKVKTKQIWQGSDLPTAPYRIITKETDLDSVIAELGLPVIIKPVHEGSSVGMSKVEKAEDFAAAIEKATQHDAVVMAEKWITGREFTISFLNGQPLPVIRLQPPADVAFYDYEAKYQRNDVEYGIPCGLSETEEKKLQALCLRAFQAVGAEGWGRIDAMQDEQGNFWLLEVNTVPGMTSHSLVPKATKAVGYSFDELCVAILEQTLEGTA

Atome Classification :

(44 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PHY_A_5(1IOW)
?
[Raw transfer]




ADP_D_18(5BPF)
DDL_YERPE
[Raw transfer]




ATP_A_3(4C5C)
DDLB_ECOLI
[Raw transfer]




ADP_A_5(1IOV)
DDLB_ECOLI
[Raw transfer]




ADP_C_11(5C1P)
DDL_YERPE
[Raw transfer]




ANP_B_8(5C1O)
DDL_YERPE
[Raw transfer]




ATP_A_3(4C5C)
DDLB_ECOLI
[Raw transfer]




ATP_B_11(4C5C)
DDLB_ECOLI
[Raw transfer]




ADP_A_3(4C5B)
DDLB_ECOLI
[Raw transfer]




ADP_D_19(5C1P)
DDL_YERPE
[Raw transfer]




ADP_B_10(4C5A)
DDLB_ECOLI
[Raw transfer]




ADP_A_4(4C5A)
DDLB_ECOLI
[Raw transfer]




ANP_D_15(5C1O)
DDL_YERPE
[Raw transfer]




ADP_B_8(5C1P)
DDL_YERPE
[Raw transfer]




ADP_C_13(5BPF)
DDL_YERPE
[Raw transfer]




ADP_B_12(4C5B)
DDLB_ECOLI
[Raw transfer]




AMP_B_11(5BPH)
DDL_YERPE
[Raw transfer]




AMP_C_16(5BPH)
DDL_YERPE
[Raw transfer]




ANP_C_12(5C1O)
DDL_YERPE
[Raw transfer]




ADP_A_4(2DLN)
DDLB_ECOLI
[Raw transfer]




ADP_B_9(5BPF)
DDL_YERPE
[Raw transfer]




ADP_A_4(1IOW)
DDLB_ECOLI
[Raw transfer]




ANP_A_5(5C1O)
DDL_YERPE
[Raw transfer]




AMP_D_21(5BPH)
DDL_YERPE
[Raw transfer]




AMP_A_5(5BPH)
DDL_YERPE
[Raw transfer]




ADP_A_4(1IOW)
?
[Raw transfer]




PHY_A_6(1EHI)
DDL_LEUMM
[Raw transfer]




PHY_A_6(1EHI)
DDL_LEUMM
[Raw transfer]




PHY_B_16(1E4E)
VANA_ENTFC
[Raw transfer]




DAL_C_6(2YZM)
DDL_THET8
[Raw transfer]




DAL_B_5(2YZM)
DDL_THET8
[Raw transfer]




DAL_A_4(2ZDQ)
DDL_THET8
[Raw transfer]




DAL_A_13(2ZDH)
DDL_THET8
[Raw transfer]




DAL_B_6(2ZDQ)
DDL_THET8
[Raw transfer]




DAL_D_17(2ZDH)
DDL_THET8
[Raw transfer]




DAL_A_4(2YZM)
DDL_THET8
[Raw transfer]




EDO_B_5(4EG0)
DDL_BURA4
[Raw transfer]




EDO_B_5(4EG0)
DDL_BURA4
[Raw transfer]




EDO_A_4(4EG0)
DDL_BURA4
[Raw transfer]




G1L_A_3(2I80)
DDL_STAAC
[Raw transfer]




G1L_B_4(2I80)
DDL_STAAC
[Raw transfer]




90 HHSearch 88.43100%-111 - C2 -5D8D - DDL_ACIBC -
1 PsiBlast_PDB 87.0999%-111 - C2 -5D8D - DDL_ACIBC -
91 HHSearch 84.73100%-106 - C2 -5D8D - DDL_ACIBC -
2 PsiBlast_PDB 76.9999%-112 - C2 -5DMX - DDL_ACIBC -
28 PsiBlast_CBE 72.6653% -21 - C2 -5BPH 7.2 DDL_YERPE
29 PsiBlast_CBE 72.0953% -16 - C2 -5BPH 6.8 DDL_YERPE
30 PsiBlast_CBE 72.0053% -15 - C2 -5BPH 6.6 DDL_YERPE
22 PsiBlast_CBE 71.8353% -19 - C2 -5C1P 6.4 DDL_YERPE
6 PsiBlast_PDB 71.5353% -20 - C2 -5BPH 6.7 DDL_YERPE
94 HHSearch 71.3854% -11 - C2 -4ZQI - DDL_YERPE -
23 PsiBlast_CBE 71.2353% -17 - C2 -5C1P 6.1 DDL_YERPE
25 PsiBlast_CBE 70.7753% -29 - C2 -5C1O 5.7 DDL_YERPE
26 PsiBlast_CBE 70.4353% -16 - C2 -5C1O 6.1 DDL_YERPE
32 PsiBlast_CBE 70.1153% -17 - C2 -5BPF 6.7 DDL_YERPE
27 PsiBlast_CBE 69.8453% -26 - C2 -5C1O 5.1 DDL_YERPE
31 PsiBlast_CBE 69.7953% -22 - C2 -5BPF 5.7 DDL_YERPE
24 PsiBlast_CBE 69.7353% -23 - C2 -5C1P 6.1 DDL_YERPE
33 PsiBlast_CBE 69.1053% -13 - C2 -5BPF 5.5 DDL_YERPE
5 PsiBlast_PDB 68.8853% -20 - C2 -5BPF - DDL_YERPE -
7 PsiBlast_PDB 68.5853% -23 - C2 -5C1O 5.6 DDL_YERPE
37 PsiBlast_CBE 68.0551% -7 - C2 -4C5C 8.4 DDLB_ECOLI
39 PsiBlast_CBE 67.9551% -8 - C2 -4C5A 7.0 DDLB_ECOLI
10 PsiBlast_PDB 67.4951% -6 - C2 -4C5B 7.8 DDLB_ECOLI
11 PsiBlast_PDB 67.1751% -9 - C2 -4C5C 8.5 DDLB_ECOLI
9 PsiBlast_PDB 67.0351% -4 - C2 -4C5A 7.6 DDLB_ECOLI
38 PsiBlast_CBE 67.0051% -5 - C2 -4C5B 7.7 DDLB_ECOLI
14 PsiBlast_PDB 66.7252% -10 - C2 -1IOW 7.5 DDLB_ECOLI
96 HHSearch 66.3851% -3 - C2 -4C5C 8.5 DDLB_ECOLI
16 PsiBlast_PDB 66.2246% -7 - C2 -4EG0 3.4 DDL_BURA4
12 PsiBlast_PDB 65.6452% -8 - C2 -1IOV 6.9 DDLB_ECOLI
40 PsiBlast_CBE 65.4246% -0 - C2 -4EG0 2.0 DDL_BURA4
13 PsiBlast_PDB 65.1352% -10 - C2 -2DLN 6.4 DDLB_ECOLI
106 HHSearch 63.8147% 4 - C2 -4EG0 2.0 DDL_BURA4
66 PsiBlast_CBE 52.5136% -29 - C2 -2YZM 3.4 DDL_THET8
53 PsiBlast_CBE 52.3336% -28 - C2 -2ZDQ 2.5 DDL_THET8
52 PsiBlast_CBE 52.0236% -25 - C2 -2ZDQ 3.8 DDL_THET8
103 HHSearch 51.8530% 34 - C2 -1EHI 3.5 DDL_LEUMM
57 PsiBlast_CBE 51.5936% -19 - C2 -2ZDH 2.4 DDL_THET8
54 PsiBlast_CBE 51.3936% -17 - C2 -2ZDH 2.4 DDL_THET8
65 PsiBlast_CBE 51.1836% -28 - C2 -2YZM 3.6 DDL_THET8
67 PsiBlast_CBE 50.6736% -26 - C2 -2YZM 3.5 DDL_THET8
70 PsiBlast_CBE 46.1431% 31 - C2 -1EHI 3.4 DDL_LEUMM
114 Fugue 44.9350% 46 - C2 -1IOW Error ?
116 Fugue 35.2155% -85 - C2 -1IOW Error ?