@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VSA6: (2017-12-06 )
MKYNNLNEFLNYVQARDPHQPEFLQAVEEVMTSLWPFIEKNPEYAEQGLLERLVEPERVIQFRVSWMDDQGQTQVNRAFRVQYNSAIGPFKGGMRFHPSVNLSILKFLGFEQTFKNSLTTLPMGGGKGGSDFNPKGKSDAEIMRFCQALMIELYRHLGPNTDIPAGDIGVGAREVGYMAGMMKKLSNDTACVFTGKGISFGGSLMRPEATGYGTVYFAEEMLKTRGQSFAGKTVSISGSGNVAQYAAEKAMFLGAKVVTLSDSNGTVYLKNGFTDELLAEVMELKNIQRGRISEFASKHGFEYFEGKTPWHIPVDIALPCATQNELTGEDAKMLIANGVICVAEGANMPSTLEAVEHFIEAKILYAPGKASNAGGVATSGLEMSQNSIRLGWTHAEVDERLHAIMKDIHANCVRYGTKEDGTVNYVDGANIAGFVKVADAMLAQGIY

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NDP_F_(5GUD)
?
[Raw transfer]




21 PsiBlast_CBE 99.6271% -76 - C8 -4BHT - DHE4_ECOLI -
22 PsiBlast_CBE 99.5371% -75 - C8 -4BHT - DHE4_ECOLI -
25 PsiBlast_CBE 98.9471% -72 - C8 -4BHT - DHE4_ECOLI -
4 PsiBlast_PDB 98.5771% -74 - C8 -4BHT - DHE4_ECOLI -
24 PsiBlast_CBE 98.4371% -72 - C8 -4BHT - DHE4_ECOLI -
80 HHSearch 97.4171% -71 - C8 -3SBO - DHE4_ECOLI -
3 PsiBlast_PDB 96.6471% -72 - C8 -3SBO - DHE4_ECOLI -
23 PsiBlast_CBE 95.2071% -70 - C8 -4BHT - DHE4_ECOLI -
12 PsiBlast_PDB 85.0854% -52 - C8 -2BMA - ? -
75 HHSearch 85.0155% -45 - C8 -3R3J - ? -
2 PsiBlast_PDB 84.8871% - - C8 -4FHN - ? -
1 PsiBlast_PDB 84.8171% - - C8 -4FCC - ? -
6 PsiBlast_PDB 84.3655% -44 - C8 -3R3J - ? -
74 HHSearch 82.6858% -15 - C8 -5GUD - ? -
5 PsiBlast_PDB 82.5061% -30 - C8 -2YFH - DHE2_CLOSY (first) -
79 HHSearch 81.6771% - - C- -4FCC - ? -
32 PsiBlast_CBE 81.3757% -15 - C8 -5GUD - ? -
31 PsiBlast_CBE 81.2757% -13 - C8 -5GUD - ? -
9 PsiBlast_PDB 81.1054% -27 - C8 -1HRD - DHE2_CLOSY -
11 PsiBlast_PDB 80.5054% -23 - C8 -1K89 - DHE2_CLOSY -
30 PsiBlast_CBE 79.8757% -7 - C8 -5GUD 12.4 ?