@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VSC2: (2017-12-07 )
MELNPTEKDKLLIFTAGLVAERRKARGLKLNYPEAVAFISAALLEGARDGMTVSELMHFGTTLLKRKDVMDGVPEMIAEVQVEATFPDGSKLVTVHQPIV

Atome Classification :

(24 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_A_5(4CEU)
URE3_SPOPA
[Raw transfer]




EDO_A_5(4CEX)
URE3_SPOPA
[Raw transfer]




EDO_A_5(4AC7)
URE3_SPOPA
[Raw transfer]




EDO_A_5(4AC7)
URE3_SPOPA
[Raw transfer]




17 PsiBlast_PDB 89.7272%-143 - C3 -1A5M - URE3_KLEAE -
14 PsiBlast_PDB 89.5172%-140 - C3 -1FWJ - URE3_KLEAE -
8 PsiBlast_PDB 89.3872%-139 - C3 -1FWD - URE3_KLEAE -
16 PsiBlast_PDB 89.2572%-134 - C3 -1A5L - URE3_KLEAE -
7 PsiBlast_PDB 89.2072%-142 - C3 -1FWC - URE3_KLEAE -
10 PsiBlast_PDB 89.0872%-139 - C3 -1FWF - URE3_KLEAE -
6 PsiBlast_PDB 89.0572%-137 - C3 -1FWB - URE3_KLEAE -
64 Fugue 89.0372%-143 - C3 -2KAU - URE3_KLEAE -
9 PsiBlast_PDB 89.0372%-133 - C3 -1FWE - URE3_KLEAE -
1 PsiBlast_PDB 89.0372%-143 - C3 -2KAU - URE3_KLEAE -
2 PsiBlast_PDB 89.0172%-134 - C3 -1KRC - URE3_KLEAE -
5 PsiBlast_PDB 88.8972%-139 - C3 -1FWA - URE3_KLEAE -
15 PsiBlast_PDB 88.8772%-142 - C3 -1A5K - URE3_KLEAE -
12 PsiBlast_PDB 88.7172%-136 - C3 -1FWH - URE3_KLEAE -
13 PsiBlast_PDB 88.6072%-137 - C3 -1FWI - URE3_KLEAE -
45 HHSearch 88.4572%-134 - C3 -1EJX - URE3_KLEAE -
3 PsiBlast_PDB 88.4372%-141 - C3 -1KRB - URE3_KLEAE -
11 PsiBlast_PDB 88.3472%-135 - C3 -1FWG - URE3_KLEAE -
19 PsiBlast_PDB 88.1372%-134 - C3 -1A5O - URE3_KLEAE -
4 PsiBlast_PDB 88.0772%-136 - C3 -1KRA - URE3_KLEAE -
26 PsiBlast_CBE 59.3267% 3 - C3 -4CEU 3.0 URE3_SPOPA
25 PsiBlast_CBE 58.9867% 7 - C3 -4CEX 3.0 URE3_SPOPA
44 HHSearch 58.7766% 9 - C3 -4AC7 3.0 URE3_SPOPA
27 PsiBlast_CBE 57.5567% 7 - C3 -4AC7 3.0 URE3_SPOPA