@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VT69: (2017-12-11 )
MMKIAVLVSGNGSNLQALIDANLSGQIVGVLSNKADAYALERAQNANIATAVISHKDFPSREDFDEAMHQQLIAWQADVVILAGFMRILTANFVDKWQGKMLNIHPSLLPAYKGVNTHQRVLNTGDRLHGCTVHFVTSELDAGQAIAQSAIEVKEHDNVASLAERVHKLEHFIYPQVAEWLCNGQLTWKNGQAYFRNQILEHPIRFASW

Atome Classification :

(63 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

138_H_8(1JKX)
PUR3_ECOLI
[Raw transfer]




KT5_C_3(1RBZ)
PUR2_HUMAN
[Raw transfer]




3Y9_A_3(4ZYT)

[Raw transfer]




KEU_H_8(1RBY)

[Raw transfer]




KT5_H_8(1RBM)

[Raw transfer]




KEU_G_7(1NJS)

[Raw transfer]




G71_A_3(4ZYV)

[Raw transfer]




KEU_M_13(1RBQ)
PUR2_HUMAN
[Raw transfer]




KT5_D_4(1RC0)

[Raw transfer]




83A_A_3(5J9F)

[Raw transfer]




3YC_A_3(4ZYY)

[Raw transfer]




KT5_D_4(1RBZ)

[Raw transfer]




KEU_N_14(1RBQ)

[Raw transfer]




KEU_F_6(1RBY)
PUR2_HUMAN
[Raw transfer]




KT5_C_3(1RC0)
PUR2_HUMAN
[Raw transfer]




3YG_A_3(4ZZ2)

[Raw transfer]




3YB_A_3(4ZYX)

[Raw transfer]




3YF_A_3(4ZZ1)

[Raw transfer]




U89_A_3(1GAR)
PUR3_ECOLI
[Raw transfer]




KEU_F_6(1NJS)
PUR2_HUMAN
[Raw transfer]




KT3_E_5(1RC1)
PUR2_HUMAN
[Raw transfer]




KEU_E_5(1RBY)
PUR2_HUMAN
[Raw transfer]




KEU_K_11(1RBQ)
PUR2_HUMAN
[Raw transfer]




3YF_A_3(4ZZ1)

[Raw transfer]




KEU_L_12(1RBQ)
PUR2_HUMAN
[Raw transfer]




KEU_G_7(1RBY)
PUR2_HUMAN
[Raw transfer]




KT5_G_7(1RBM)
PUR2_HUMAN
[Raw transfer]




3YD_A_3(4ZYZ)

[Raw transfer]




KT3_F_6(1RC1)

[Raw transfer]




3YE_A_3(4ZZ0)

[Raw transfer]




DXY_A_5(4EW2)

[Raw transfer]




DXZ_A_5(4EW3)

[Raw transfer]




G94_A_3(4ZYW)

[Raw transfer]




4DW_A_2(4ZZ3)

[Raw transfer]




NHR_C_3(1C3E)
PUR3_ECOLI
[Raw transfer]




NHS_E_5(1C2T)
PUR3_ECOLI
[Raw transfer]




U89_B_4(1GAR)
PUR3_ECOLI
[Raw transfer]




NHR_E_5(1C3E)
PUR3_ECOLI
[Raw transfer]




NHS_C_3(1C2T)
PUR3_ECOLI
[Raw transfer]




NHR_E_5(1C3E)
PUR3_ECOLI
[Raw transfer]




GOL_E_5(1MEJ)
PUR2_HUMAN
[Raw transfer]




138_E_5(1JKX)
PUR3_ECOLI
[Raw transfer]




GOL_A_5(3KCQ)
?
[Raw transfer]




3YA_A_3(4ZYU)

[Raw transfer]




GOL_B_6(3KCQ)
?
[Raw transfer]




138_F_6(1JKX)
PUR3_ECOLI
[Raw transfer]




DZF_D_12(1CDE)
PUR3_ECOLI
[Raw transfer]




DZF_B_8(1CDE)
PUR3_ECOLI
[Raw transfer]




GOL_F_6(1MEJ)

[Raw transfer]




DZF_C_10(1CDE)
PUR3_ECOLI
[Raw transfer]




138_F_6(1JKX)
PUR3_ECOLI
[Raw transfer]




GOL_B_6(3KCQ)
?
[Raw transfer]




DZF_A_6(1CDE)
PUR3_ECOLI
[Raw transfer]




GOL_C_7(3KCQ)
?
[Raw transfer]




138_G_7(1JKX)
PUR3_ECOLI
[Raw transfer]




GOL_C_7(3KCQ)
?
[Raw transfer]




GOL_D_8(3KCQ)
?
[Raw transfer]




DQB_C_3(1ZLY)

[Raw transfer]




DQB_C_3(1ZLY)

[Raw transfer]




GAR_E_5(1MEN)
PUR2_HUMAN
[Raw transfer]




GAR_F_6(1MEN)

[Raw transfer]




GAR_D_4(1MEN)
PUR2_HUMAN
[Raw transfer]




42 PsiBlast_CBE 85.6350% -46 - C4 -1MEJ 1.9 PUR2_HUMAN
13 PsiBlast_PDB 85.3151% -48 - C4 -5J9F 5.6
21 PsiBlast_CBE 85.2251% -51 - C4 -4EW3 6.7
7 PsiBlast_PDB 85.2051% -49 - C4 -4ZYV 6.8
40 PsiBlast_CBE 85.1750% -50 - C4 -1MEJ 2.8
38 PsiBlast_CBE 85.0150% -46 - C4 -1MEN 3.5 PUR2_HUMAN
17 PsiBlast_PDB 84.9451% -45 - C4 -1RBQ 8.6 PUR2_HUMAN
50 PsiBlast_CBE 84.9147% -57 - C4 -1JKX 10.1 PUR3_ECOLI
6 PsiBlast_PDB 84.8751% -48 - C4 -4ZYU 5.2
10 PsiBlast_PDB 84.8651% -46 - C4 -4ZYY 7.0
15 PsiBlast_PDB 84.7751% -44 - C4 -1NJS 8.6 PUR2_HUMAN
33 PsiBlast_CBE 84.7651% -45 - C4 -1RBQ 8.1 PUR2_HUMAN
5 PsiBlast_PDB 84.7251% -49 - C4 -4ZYT 6.6
34 PsiBlast_CBE 84.6851% -43 - C4 -1RBQ 8.5 PUR2_HUMAN
12 PsiBlast_PDB 84.6751% -46 - C4 -4ZZ0 5.3
4 PsiBlast_PDB 84.6151% -45 - C4 -4ZZ3 6.0
27 PsiBlast_CBE 84.5851% -43 - C4 -1RC0 6.5
61 PsiBlast_CBE 84.5647% -50 - C4 -1C2T 8.1 PUR3_ECOLI
35 PsiBlast_CBE 84.5351% -44 - C4 -1RBM 7.8
14 PsiBlast_PDB 84.5351% -43 - C4 -1MEO - -
37 PsiBlast_CBE 84.4850% -43 - C4 -1MEN 3.9
36 PsiBlast_CBE 84.4351% -43 - C4 -1NJS 7.6
9 PsiBlast_PDB 84.4351% -49 - C4 -4ZYX 7.2
26 PsiBlast_CBE 84.4051% -42 - C4 -1RC1 8.7 PUR2_HUMAN
49 PsiBlast_CBE 84.2947% -56 - C4 -1JKX 10.9 PUR3_ECOLI
32 PsiBlast_CBE 84.2851% -41 - C4 -1RBQ 7.4
31 PsiBlast_CBE 84.2551% -44 - C4 -1RBY 9.2 PUR2_HUMAN
2 PsiBlast_PDB 84.2351% -47 - C4 -4ZZ1 6.6
30 PsiBlast_CBE 84.2251% -49 - C4 -1RBY 7.4 PUR2_HUMAN
16 PsiBlast_PDB 84.2251% -44 - C4 -1RBM 7.6 PUR2_HUMAN
39 PsiBlast_CBE 84.2050% -45 - C4 -1MEN 4.0 PUR2_HUMAN
45 PsiBlast_CBE 84.1947% -50 * C4 *1C3E 8.6 PUR3_ECOLI
28 PsiBlast_CBE 84.1551% -44 - C4 -1RBZ 7.6
114 HHSearch 84.1147% -48 - C4 -1C3E 8.6 PUR3_ECOLI
19 PsiBlast_PDB 84.0451% -45 - C4 -1RBZ 8.8 PUR2_HUMAN
11 PsiBlast_PDB 84.0451% -47 - C4 -4ZYZ 6.4
126 HHSearch 84.0248% -55 - C4 -1JKX 10.9 PUR3_ECOLI
18 PsiBlast_PDB 84.0251% -43 - C4 -1RBY 9.4 PUR2_HUMAN
8 PsiBlast_PDB 84.0051% -47 - C4 -4ZYW 5.8
58 PsiBlast_CBE 83.9447% -56 - C4 -1CDE 6.4 PUR3_ECOLI
25 PsiBlast_CBE 83.8951% -46 - C4 -1RC1 8.4
48 PsiBlast_CBE 83.8347% -57 - C4 -1JKX 10.6 PUR3_ECOLI
3 PsiBlast_PDB 83.8151% -46 - C4 -4ZZ2 6.5
29 PsiBlast_CBE 83.7651% -48 - C4 -1RBY 7.0
46 PsiBlast_CBE 83.7247% -49 - C4 -1C3E 9.0 PUR3_ECOLI
62 PsiBlast_CBE 83.7047% -49 - C4 -1C2T 8.5 PUR3_ECOLI
134 HHSearch 83.5551% -51 - C4 -1ZLY 5.9
56 PsiBlast_CBE 83.5247% -56 - C4 -1CDE 6.4 PUR3_ECOLI
20 PsiBlast_PDB 83.4851% -41 - C4 -1RC0 7.9 PUR2_HUMAN
57 PsiBlast_CBE 83.3947% -56 - C4 -1CDE 6.4 PUR3_ECOLI
55 PsiBlast_CBE 83.3847% -56 - C4 -1CDE 6.4 PUR3_ECOLI
47 PsiBlast_CBE 83.2247% -57 - C4 -1JKX 10.0 PUR3_ECOLI
24 PsiBlast_CBE 83.1651% -43 - C4 -1ZLY 5.9
22 PsiBlast_CBE 83.1351% -50 - C4 -4EW2 6.9
115 HHSearch 83.0851% -50 - C4 -4ZZ1 6.6
54 PsiBlast_CBE 80.1547% -51 - C4 -1GAR 9.3 PUR3_ECOLI
53 PsiBlast_CBE 77.9247% -55 - C4 -1GAR 9.9 PUR3_ECOLI
123 HHSearch 75.8039% -43 - C4 -3KCQ 2.3 ?
122 HHSearch 74.7539% -49 - C4 -3KCQ 2.4 ?
65 PsiBlast_CBE 70.8941% -63 - C4 -3KCQ 2.3 ?
64 PsiBlast_CBE 66.4741% -33 - C4 -3KCQ 2.4 ?
63 PsiBlast_CBE 66.2641% -38 - C4 -3KCQ 2.7 ?
66 PsiBlast_CBE 66.1841% -33 - C4 -3KCQ 2.5 ?