@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VUV9: (2017-12-20 )
MRIAGRLAAEVLDMIKPHIKAGVSTLELDTICRNHIENVQHAIPACVGYGGAPGRPAFQHSICTSVNHVVCHGIPSENKILKNGDILNIDVTVIKDGYHGDTNMMYIVGGETSILANRLCKVAQEAMYRGMATVRDGSYLGDIGHAIQKHVESERFSVVREYCGHGIGTVFHDEPQVLHYGQAGTGMRLEAGMTFTIEPMVNAGVWQTKLLGDKWTVVTKDHKLSAQYEHTILVTKTGIEVLTARPEEDLSRFNQ

Atome Classification :

(82 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

U17_A_5(2GGB)
MAP1_ECOLI
[Raw transfer]




NLP_A_9(2GU6)
MAP1_ECOLI
[Raw transfer]




NLP_B_10(2GU6)
MAP1_ECOLI
[Raw transfer]




NLP_A_5(1C27)
MAP1_ECOLI
[Raw transfer]




NLP_A_9(2GU4)
MAP1_ECOLI
[Raw transfer]




NLP_A_7(2GTX)
MAP1_ECOLI
[Raw transfer]




NLP_B_8(2GTX)
MAP1_ECOLI
[Raw transfer]




Q04_A_5(4U70)
MAP11_HUMAN
[Raw transfer]




NLP_A_9(2GU5)
MAP1_ECOLI
[Raw transfer]




Y16_A_2(3PKB)
MAP12_MYCTU
[Raw transfer]




Q07_A_6(4U6Z)
MAP11_HUMAN
[Raw transfer]




NLP_B_10(2GU5)
MAP1_ECOLI
[Raw transfer]




NLP_B_10(2GU4)
MAP1_ECOLI
[Raw transfer]




Q06_A_6(4U6C)
MAP11_HUMAN
[Raw transfer]




Q08_A_5(4U1B)
MAP11_HUMAN
[Raw transfer]




Q08_A_6(4U6W)
MAP11_HUMAN
[Raw transfer]




Q07_A_5(4U69)
MAP11_HUMAN
[Raw transfer]




U16_A_5(2GG9)
MAP1_ECOLI
[Raw transfer]




U15_A_5(2GG8)
MAP1_ECOLI
[Raw transfer]




MPH_A_5(1C23)
MAP1_ECOLI
[Raw transfer]




Y10_A_4(3PKD)
MAP12_MYCTU
[Raw transfer]




Y02_A_4(3PKA)
MAP12_MYCTU
[Raw transfer]




Q03_A_6(4U71)
MAP11_HUMAN
[Raw transfer]




YE7_A_4(2P98)
MAP1_ECOLI
[Raw transfer]




Q02_A_5(4U73)
MAP11_HUMAN
[Raw transfer]




Q02_A_4(4U6E)
MAP11_HUMAN
[Raw transfer]




Y10_A_2(3PKE)
MAP12_MYCTU
[Raw transfer]




MPJ_A_5(1C24)
MAP1_ECOLI
[Raw transfer]




5C1_A_3(4A6W)
?
[Raw transfer]




W29_A_4(3D27)
MAP1_ECOLI
[Raw transfer]




Y08_A_4(3PKC)
MAP12_MYCTU
[Raw transfer]




Y16_A_4(4FLI)
MAP11_HUMAN
[Raw transfer]




U11_A_5(2GG0)
MAP1_ECOLI
[Raw transfer]




IKY_A_5(4A6V)
?
[Raw transfer]




Y08_A_4(4FLJ)
MAP11_HUMAN
[Raw transfer]




U14_A_5(2GG7)
MAP1_ECOLI
[Raw transfer]




Y10_A_4(4FLK)
MAP11_HUMAN
[Raw transfer]




IKY_B_7(4A6V)
?
[Raw transfer]




GOL_A_9(2B3H)
MAP11_HUMAN
[Raw transfer]




U12_A_5(2GG2)
MAP1_ECOLI
[Raw transfer]




B21_A_5(2Q93)
MAP1_ECOLI
[Raw transfer]




U13_A_5(2GG3)
MAP1_ECOLI
[Raw transfer]




GOL_A_4(2B3L)
MAP11_HUMAN
[Raw transfer]




A18_A_5(2Q96)
MAP1_ECOLI
[Raw transfer]




GOL_A_9(2B3H)
MAP11_HUMAN
[Raw transfer]




YE6_A_4(2P99)
MAP1_ECOLI
[Raw transfer]




YZ6_A_4(4FLL)
MAP11_HUMAN
[Raw transfer]




FCD_A_5(1XNZ)
MAP1_ECOLI
[Raw transfer]




FC2_A_5(2EVM)
MAP1_ECOLI
[Raw transfer]




GOL_A_6(4U76)
MAP11_HUMAN
[Raw transfer]




A05_A_5(2Q95)
MAP1_ECOLI
[Raw transfer]




HCM_A_4(4IF7)
MAP12_MYCTU
[Raw transfer]




FCD_A_4(3IU7)
MAP12_MYCTU
[Raw transfer]




FC3_A_5(2EVC)
MAP1_ECOLI
[Raw transfer]




A05_A_5(2Q95)
MAP1_ECOLI
[Raw transfer]




A04_A_5(2Q94)
MAP1_ECOLI
[Raw transfer]




B23_A_5(2Q92)
MAP1_ECOLI
[Raw transfer]




MF3_A_5(1C22)
MAP1_ECOLI
[Raw transfer]




U19_A_5(2GG5)
MAP1_ECOLI
[Raw transfer]




4L9_B_6(4Z7M)
MAP1_ECOLI
[Raw transfer]




4L9_A_4(4Z7M)
MAP1_ECOLI
[Raw transfer]




T03_A_5(3IU8)
MAP12_MYCTU
[Raw transfer]




T07_A_4(3IU9)
MAP12_MYCTU
[Raw transfer]




QMS_A_6(2BB7)
MAP1_ECOLI
[Raw transfer]




TFV_A_2(4IKT)
MAP11_HUMAN
[Raw transfer]




TMG_A_7(1YVM)
MAP1_ECOLI
[Raw transfer]




CIT_B_5(3TB5)
?
[Raw transfer]




7NP_A_2(4PNC)
?
[Raw transfer]




HM2_A_6(2G6P)
MAP11_HUMAN
[Raw transfer]




SHX_A_2(4IKU)
MAP11_HUMAN
[Raw transfer]




CT0_A_10(2EVO)
MAP1_ECOLI
[Raw transfer]




FZ1_A_6(4IU6)
MAP11_HUMAN
[Raw transfer]




LMR_A_8(3TAV)
?
[Raw transfer]




PVP_A_5(4IKR)
MAP11_HUMAN
[Raw transfer]




1AY_A_6(4HXX)
MAP11_HUMAN
[Raw transfer]




HED_A_2(4IDY)
MAP12_MYCTU
[Raw transfer]




HM5_A_6(2NQ7)
MAP11_HUMAN
[Raw transfer]




HM4_A_6(2NQ6)
MAP11_HUMAN
[Raw transfer]




CT0_B_9(2EVO)
MAP1_ECOLI
[Raw transfer]




YE6_A_5(2P9A)
MAP1_ECOLI
[Raw transfer]




1AY_A_6(4HXX)
MAP11_HUMAN
[Raw transfer]




FZ1_A_6(4IU6)
MAP11_HUMAN
[Raw transfer]




36 PsiBlast_CBE 95.5960%-112 - C3 -2GTX 3.8 MAP1_ECOLI
58 PsiBlast_CBE 95.1260%-111 - C3 -2P99 4.9 MAP1_ECOLI
56 PsiBlast_CBE 95.0960%-108 - C3 -4Z7M 7.8 MAP1_ECOLI
35 PsiBlast_CBE 95.0960%-111 - C3 -2GU4 3.8 MAP1_ECOLI
34 PsiBlast_CBE 94.9660%-109 - C3 -2GU5 3.8 MAP1_ECOLI
40 PsiBlast_CBE 94.9460%-103 - C3 -2EVC 5.0 MAP1_ECOLI
53 PsiBlast_CBE 94.8560%-107 - C3 -2GG3 4.1 MAP1_ECOLI
61 PsiBlast_CBE 94.7760%-106 - C3 -2P9A 3.3 MAP1_ECOLI
60 PsiBlast_CBE 94.7360%-107 - C3 -2Q92 3.6 MAP1_ECOLI
33 PsiBlast_CBE 94.6460%-109 - C3 -2GU6 3.9 MAP1_ECOLI
39 PsiBlast_CBE 94.6260%-106 - C3 -2EVM 4.6 MAP1_ECOLI
50 PsiBlast_CBE 94.6160%-106 - C3 -2GG8 4.6 MAP1_ECOLI
42 PsiBlast_CBE 94.5660%-105 - C3 -1XNZ 4.3 MAP1_ECOLI
62 PsiBlast_CBE 94.4760%-109 - C3 -2P98 4.7 MAP1_ECOLI
16 PsiBlast_PDB 94.3560%-108 - C3 -2GTX 3.8 MAP1_ECOLI
48 PsiBlast_CBE 94.3060%-107 - C3 -2GGB 3.7 MAP1_ECOLI
38 PsiBlast_CBE 94.3060%-107 - C3 -2EVO 3.0 MAP1_ECOLI
57 PsiBlast_CBE 94.2960%-106 - C3 -4Z7M 7.6 MAP1_ECOLI
44 PsiBlast_CBE 94.2660%-106 - C3 -2Q96 4.6 MAP1_ECOLI
45 PsiBlast_CBE 94.2260%-111 - C3 -2Q95 4.5 MAP1_ECOLI
17 PsiBlast_PDB 94.1960%-106 - C3 -3D27 4.3 MAP1_ECOLI
14 PsiBlast_PDB 94.1660%-109 - C3 -4A6V 4.5 ?
41 PsiBlast_CBE 94.0160%-110 - C3 -2BB7 3.7 MAP1_ECOLI
54 PsiBlast_CBE 94.0060%-107 - C3 -2GG2 4.4 MAP1_ECOLI
12 PsiBlast_PDB 93.8460%-111 - C3 -1C23 3.6 MAP1_ECOLI
19 PsiBlast_PDB 93.8360%-111 - C3 -2GU5 3.8 MAP1_ECOLI
55 PsiBlast_CBE 93.7860%-105 - C3 -2GG0 5.0 MAP1_ECOLI
30 PsiBlast_CBE 93.7560%-107 - C3 -4A6V 4.5 ?
51 PsiBlast_CBE 93.6960%-104 - C3 -2GG7 4.0 MAP1_ECOLI
18 PsiBlast_PDB 93.6460%-110 - C3 -2GU4 3.9 MAP1_ECOLI
20 PsiBlast_PDB 93.5860%-106 - C3 -2GU6 4.0 MAP1_ECOLI
49 PsiBlast_CBE 93.5560%-104 - C3 -2GG9 5.8 MAP1_ECOLI
59 PsiBlast_CBE 93.4860%-106 - C3 -2Q94 4.3 MAP1_ECOLI
46 PsiBlast_CBE 93.3660%-106 - C3 -2Q93 4.0 MAP1_ECOLI
37 PsiBlast_CBE 93.3360%-107 - C3 -2EVO 3.0 MAP1_ECOLI
13 PsiBlast_PDB 93.2560%-109 - C3 -1C24 3.4 MAP1_ECOLI
9 PsiBlast_PDB 93.2060%-111 - C3 -1C27 3.5 MAP1_ECOLI
52 PsiBlast_CBE 93.1560%-106 - C3 -2GG5 4.1 MAP1_ECOLI
11 PsiBlast_PDB 93.0360%-108 - C3 -1C22 2.9 MAP1_ECOLI
7 PsiBlast_PDB 92.8260%-106 - C3 -4A6W 4.2 ?
6 PsiBlast_PDB 92.3160%-111 - C3 -1YVM 3.6 MAP1_ECOLI
8 PsiBlast_PDB 91.4660%-107 - C3 -4PNC 2.7 ?
131 HHSearch 85.9643%-111 - C3 -4HXX 5.2 MAP11_HUMAN
126 HHSearch 85.3843%-109 - C3 -4IU6 4.2 MAP11_HUMAN
124 HHSearch 85.3043%-110 - C3 -2B3H 2.4 MAP11_HUMAN
135 HHSearch 84.5059% -31 - C3 -2Q95 4.7 MAP1_ECOLI
71 PsiBlast_CBE 83.0340%-110 - C3 -3TB5 3.1 ?
119 PsiBlast_CBE 75.6239% -51 - C3 -3TAV 2.3 ?
94 PsiBlast_CBE 74.4544% -56 - C3 -3PKD 7.4 MAP12_MYCTU
95 PsiBlast_CBE 74.2444% -55 - C3 -3PKC 6.4 MAP12_MYCTU
99 PsiBlast_CBE 74.0942% -31 - C3 -2NQ6 4.1 MAP11_HUMAN
86 PsiBlast_CBE 74.0544% -54 - C3 -3IU9 5.8 MAP12_MYCTU
93 PsiBlast_CBE 74.0444% -52 - C3 -3PKE 7.4 MAP12_MYCTU
79 PsiBlast_CBE 74.0042% -32 - C3 -4U1B 3.3 MAP11_HUMAN
74 PsiBlast_CBE 73.7342% -33 - C3 -2G6P 5.4 MAP11_HUMAN
92 PsiBlast_CBE 73.6042% -34 - C3 -4IKR 5.0 MAP11_HUMAN
101 PsiBlast_CBE 73.5142% -30 - C3 -2B3L 2.1 MAP11_HUMAN
97 PsiBlast_CBE 73.4344% -53 - C3 -3PKA 7.4 MAP12_MYCTU
89 PsiBlast_CBE 73.3142% -31 - C3 -4IKU 5.8 MAP11_HUMAN
76 PsiBlast_CBE 73.3042% -33 - C3 -4U6E 2.9 MAP11_HUMAN
109 PsiBlast_CBE 73.2442% -32 - C3 -4U73 3.0 MAP11_HUMAN
90 PsiBlast_CBE 73.2042% -31 - C3 -4IKT 6.4 MAP11_HUMAN
73 PsiBlast_CBE 73.1742% -32 - C3 -4HXX 5.2 MAP11_HUMAN
87 PsiBlast_CBE 73.1544% -52 - C3 -3IU8 4.3 MAP12_MYCTU
98 PsiBlast_CBE 73.0542% -32 - C3 -2NQ7 4.1 MAP11_HUMAN
84 PsiBlast_CBE 73.0344% -53 - C3 -4IF7 2.4 MAP12_MYCTU
80 PsiBlast_CBE 73.0044% -23 - C3 -4FLL 7.7 MAP11_HUMAN
78 PsiBlast_CBE 72.9942% -33 - C3 -4U69 3.0 MAP11_HUMAN
85 PsiBlast_CBE 72.9144% -56 - C3 -4IDY 2.7 MAP12_MYCTU
70 PsiBlast_CBE 72.9143% -13 - C3 -4IU6 3.6 MAP11_HUMAN
77 PsiBlast_CBE 72.8642% -32 - C3 -4U6C 3.3 MAP11_HUMAN
96 PsiBlast_CBE 72.6644% -55 - C3 -3PKB 5.7 MAP12_MYCTU
83 PsiBlast_CBE 72.6644% -21 - C3 -4FLI 5.2 MAP11_HUMAN
88 PsiBlast_CBE 72.3144% -52 - C3 -3IU7 4.3 MAP12_MYCTU
81 PsiBlast_CBE 72.2244% -22 - C3 -4FLK 6.9 MAP11_HUMAN
82 PsiBlast_CBE 72.1444% -21 - C3 -4FLJ 6.1 MAP11_HUMAN
107 PsiBlast_CBE 72.0542% -30 - C3 -4U76 1.9 MAP11_HUMAN
113 PsiBlast_CBE 72.0342% -32 - C3 -4U6W 3.3 MAP11_HUMAN
111 PsiBlast_CBE 72.0242% -31 - C3 -4U70 3.4 MAP11_HUMAN
110 PsiBlast_CBE 71.9442% -31 - C3 -4U71 3.5 MAP11_HUMAN
103 PsiBlast_CBE 71.9342% -28 - C3 -2B3H 2.4 MAP11_HUMAN
112 PsiBlast_CBE 71.8442% -31 * C3 *4U6Z 4.0 MAP11_HUMAN