@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3XXM3: (2018-01-05 )
MKVVQTKDTMSNIYLDAVRIRHQVFVVEQGVPLSREIDKDEAHCIHFVLYSDKKEPQGTVRLLPLENGKMKLQRMAILSEYRHQGLGKILIEEAENFAKNQGYNTILLGAQSTAETFYEKLGYTAYGDPFEDAGMPHIYMKKTL

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

COA_C_11(5JPH)
ATSE_STAAC
[Raw transfer]




COA_A_5(5JPH)
ATSE_STAAC
[Raw transfer]




45 HHSearch 74.2436%-102 - C2 -5JPH 9.6 ATSE_STAAC
2 PsiBlast_PDB 68.7837%-107 - C2 -5JPH 8.8 ATSE_STAAC
34 Fugue 68.5138% -91 - C2 -1Q2Y - YJCF_BACSU -
1 PsiBlast_PDB 68.4437%-124 - C2 -5JQ4 - ATSE_STAAC -
3 PsiBlast_PDB 63.9139% -86 - C2 -1Q2Y - YJCF_BACSU -
46 HHSearch 63.1437% -80 - C2 -1Q2Y - YJCF_BACSU -
4 PsiBlast_PDB 54.0132% -3 - C2 -3EFA - ? -
19 PsiBlast_PDB 53.0128%-177 - C2 -3D8P - ? -
24 PsiBlast_CBE 52.4133%-250 - C2 -1I1D - GNA1_YEAST -
51 HHSearch 52.2122% -39 - C2 -1N71 - ? -
44 HHSearch 51.8827% -30 - C2 -3EFA - ? -
11 PsiBlast_PDB 50.9533%-263 - C2 -1I21 - GNA1_YEAST -
25 PsiBlast_CBE 50.4733%-260 - C2 -1I1D - GNA1_YEAST -
47 HHSearch 50.4128% -32 - C2 -1XEB - ? -
18 PsiBlast_PDB 50.1431%-154 - C2 -3PP9 - ? -
10 PsiBlast_PDB 49.6133%-262 - C2 -1I1D - GNA1_YEAST -
23 PsiBlast_CBE 49.4433%-256 - C2 -1I12 - GNA1_YEAST -
9 PsiBlast_PDB 49.2233%-244 - C2 -1I12 - GNA1_YEAST -
21 PsiBlast_CBE 48.6033%-248 - C2 -1I12 - GNA1_YEAST -
26 PsiBlast_CBE 48.5733%-251 - C2 -1I1D - GNA1_YEAST -