@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3XYA1: (2018-01-08 )
MNIKQVSEEKGISADTLRYYERIGLIPPVNRTKGGIRDYTEEDLKWVDFTICMRNAGLSIESLIEYIRLSSEGEATVFERRKLLIEESELLTKEIAEMQECLERLQGKIKKYDRVLSRNKMECIK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_B_4(3GP4)
?
[Raw transfer]




GOL_A_3(3GP4)
?
[Raw transfer]




GOL_A_3(3GP4)
?
[Raw transfer]




49 HHSearch 96.0253%-117 - C1 -3GP4 3.0 ?
1 PsiBlast_PDB 95.5353%-117 - C1 -3GP4 3.0 ?
21 PsiBlast_CBE 95.4553%-128 - C1 -3GP4 2.7 ?
51 HHSearch 79.4530%-106 - C1 -5E01 - Y186_HAEIN -
54 HHSearch 79.4231%-108 - C1 -5D8C - Y186_HAEIN -
5 PsiBlast_PDB 77.0230%-133 - C1 -5D90 - Y186_HAEIN -
4 PsiBlast_PDB 76.5532%-116 - C1 -5D8C - Y186_HAEIN -
23 PsiBlast_CBE 76.3432%-107 - C1 -5D8C - Y186_HAEIN -
22 PsiBlast_CBE 75.7932%-106 - C1 -5E01 - Y186_HAEIN -
53 HHSearch 75.5530%-164 - C1 -3GPV - ? -
2 PsiBlast_PDB 75.2032%-163 - C1 -3GPV - ? -
3 PsiBlast_PDB 75.0632%-116 - C1 -5E01 - Y186_HAEIN -
61 HHSearch 70.5127%-149 - C1 -1R8D - MTA_BACSU -
62 HHSearch 69.4827%-144 - C1 -1R8D - MTA_BACSU -
8 PsiBlast_PDB 69.2025%-123 - C1 -1Q07 - CUER_ECOLI -
19 PsiBlast_PDB 68.6628% -44 - C1 -5XQL - ? -
6 PsiBlast_PDB 68.5925%-111 - C1 -1Q05 - CUER_ECOLI -
12 PsiBlast_PDB 67.3627%-185 - C1 -1JBG - MTA_BACSU -
10 PsiBlast_PDB 66.7725%-115 - C1 -4WLW - CUER_ECOLI -
7 PsiBlast_PDB 66.5325%-121 - C1 -1Q06 - CUER_ECOLI -