@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3Y0I2: (2018-01-20 )
MIEFINVSKSYGKKQALKDLSLSIRQGEIFGFLGHNGAGKSTTIKSLVSIIEPSSGTILVDGMKLTENRLSIKQKIGYVPDSPDIFLQLTAGEYWDLISAAYELDTQKKEKRLAELTALFDMYSHQNETIASFSHGMRQKTILIGTLLPDPDIWVLDEPLQGLDPQAAFDLKEMMKAHAAKGKTVIFSTHVLDTAQQLCDKLAILKKGELIYQGAVSELLNGSPDETLEKIYLKMAGRQATGDGPYV

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_A_3(4YER)
?
[Raw transfer]




GOL_B_11(4P33)
LPTB_ECOLI
[Raw transfer]




1 PsiBlast_PDB 89.4632%-122 - C1 -4RVC - ? -
29 HHSearch 83.1333%-111 - C1 -4YER - ? -
2 PsiBlast_PDB 72.9929%-118 - C1 -1VPL - ? -
20 PsiBlast_PDB 70.5429% 40 - C- -2YZ2 - ECFA2_THEMA -
7 PsiBlast_PDB 70.2833% -90 - C1 -4YER 6.9 ?
12 PsiBlast_PDB 69.6529% -12 - C1 -3GFO - ECFA3_CLOP1 -
9 PsiBlast_PDB 66.3829% 4 - C1 -3TUI - METN_ECOLI -
19 PsiBlast_PDB 62.1829% 15 - C1 -3TUJ - METN_ECOLI -
10 PsiBlast_PDB 61.7829% 10 - C1 -3TUZ - METN_ECOLI -
6 PsiBlast_PDB 61.7830% 19 - C1 -3DHW - METN_ECOLI -
35 HHSearch 61.7724%-112 - C1 -3RLF - MALK_ECOLI -
34 HHSearch 60.3324%-114 - C1 -2AWN - MALK_ECOLI -
45 HHSearch 59.3127% 2 - C1 -5X3X - CBIO_RHOCB -
32 HHSearch 59.2027% -48 - C1 -3FVQ - FBPC_NEIG1 -
8 PsiBlast_PDB 59.1729% -4 - C1 -4P33 2.5 LPTB_ECOLI
13 PsiBlast_PDB 59.0429% -9 - C1 -4WBS - ? -
4 PsiBlast_PDB 58.2630% 7 - C1 -4QC2 - ? -
3 PsiBlast_PDB 58.0729% -14 - C1 -4P31 - LPTB_ECOLI -
41 HHSearch 57.9525% -95 - C1 -2YYZ - ? -
5 PsiBlast_PDB 57.5930% 2 - C1 -4P32 - LPTB_ECOLI -