@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3Y1M8: (2018-01-26 )
MCTSITYVTSDHYFGRNFDYEISYNEVVTVTPRNYKLNFRKVNDLDTHYAMIGIAAGIADYPLYYDATNEKGLSMAGLNFSGYADYKEIQEGKDNVSPFEFIPWILGQCSTVGEAKKLLKNINLANINYSDELPLSPLHWLLADKEKSIVIESMKDGLHIYDNPVGVLTNNPSFDYQLFNLNNYRVLSSETPKNNFSNQISLNAYSRGMGGIGLPGDLSSVSRFVKATFTKLNSVSGDSESESISQFFHILGSVEQQKGLCDVGDGKYEYTIYSSCCNVDKGIYYYRTYEDSQITAIDMNKEDLDSHKLISYPIIEKQQIKYIN

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GLY_A_5(2RLC)
CBH_CLOPE
[Raw transfer]




1 PsiBlast_PDB 88.5382% -85 - C3 -4WL3 - ? -
49 HHSearch 73.0255% -31 - C3 -5HKE - ? -
2 PsiBlast_PDB 72.5854% -31 - C3 -5HKE - ? -
48 HHSearch 66.2040% 19 - C3 -2RG2 - CBH_CLOPE -
46 HHSearch 65.9732% 7 * C3 *2QUY - PAC_LYSSH -
6 PsiBlast_PDB 65.4641% 22 - C3 -2RG2 - CBH_CLOPE -
23 PsiBlast_CBE 65.1441% 29 - C3 -2RF8 - CBH_CLOPE -
47 HHSearch 64.8241% 23 - C3 -2BJF - CBH_CLOPE -
3 PsiBlast_PDB 64.7642% 35 - C3 -2BJF - CBH_CLOPE -
5 PsiBlast_PDB 64.3241% 39 - C3 -2RF8 - CBH_CLOPE -
4 PsiBlast_PDB 64.1242% 33 - C3 -2BJG - CBH_CLOPE -
22 PsiBlast_CBE 63.9742% 33 - C3 -2BJG - CBH_CLOPE -
12 PsiBlast_PDB 63.7831% 17 - C3 -2QUY - PAC_LYSSH -
32 PsiBlast_CBE 63.4732% 21 - C3 -2Z71 - PAC_LYSSH -
14 PsiBlast_PDB 63.2132% 25 - C3 -3MJI - PAC_LYSSH -
13 PsiBlast_PDB 62.8532% 24 - C3 -2IWM - PAC_LYSSH -
52 HHSearch 61.9232% 9 - C3 -3PVA - PAC_LYSSH -
15 PsiBlast_PDB 61.8132% 24 - C3 -2Z71 - PAC_LYSSH -
8 PsiBlast_PDB 61.7238% 20 - C3 -2HF0 - ? -
36 Fugue 60.7432% 22 - C3 -3PVA - PAC_LYSSH -