@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3Y2S1: (2018-02-01 )
MFLLTGGNGQLGTELRHLLDEKNLQYVSTDAKDLDITDAEKTMAYITELKPDVIFHCAAYTAVDKAEEEAKELDEKINVDGTRNVALAAKAVNAQFVYISTDYVFDGKNKNVEYEVDDQTNPLNEYGRTKLLGEKAVEEILEDYYIIRTSWVFGIYGHNFVFTMQRLAETRDKLTVVNDQFGRPTWTRTLAEFMVYVIEEKAPFGIYHLSNENSCSWYEFAKEILKDTDVEVAPVTSEEFPQKATRPQYSVMSLKKTEELGFVIPTWQEALAQMLEAAKKMNK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAI_A_4(1VL0)
?
[Raw transfer]




NAI_C_7(1VL0)
?
[Raw transfer]




NDP_A_3(1KC3)
RMLD_SALTY
[Raw transfer]




NDP_C_3(2GGS)
?
[Raw transfer]




TRH_A_4(1KC3)
RMLD_SALTY
[Raw transfer]




1 PsiBlast_PDB 91.9158% -31 - C2 -4WPG - ? -
57 HHSearch 86.2159% 4 - C2 -4WPG - ? -
2 PsiBlast_PDB 83.6746% -73 - C2 -1VL0 11.1 ?
25 PsiBlast_CBE 83.0342% -86 - C2 -3SC6 - ? -
22 PsiBlast_CBE 81.1342% -83 - C2 -3SC6 - ? -
3 PsiBlast_PDB 81.0542% -77 - C2 -3SC6 - ? -
23 PsiBlast_CBE 80.7642% -77 - C2 -3SC6 - ? -
24 PsiBlast_CBE 80.4142% -80 - C2 -3SC6 - ? -
21 PsiBlast_CBE 79.9042% -78 - C2 -3SC6 - ? -
63 HHSearch 75.5645% -2 * C2 *1VL0 11.9 ?
59 HHSearch 74.3742% -10 - C2 -3SC6 - ? -
58 HHSearch 74.3042% -9 - C2 -3SC6 - ? -
8 PsiBlast_PDB 72.8532% -79 - C2 -5U9C - ? -
4 PsiBlast_PDB 70.5135% -4 - C2 -1KBZ - RMLD_SALTY -
7 PsiBlast_PDB 70.4635% -6 - C2 -1N2S - RMLD_SALTY -
5 PsiBlast_PDB 70.3835% -9 - C2 -1KC1 - RMLD_SALTY -
6 PsiBlast_PDB 67.9235% -7 - C2 -1KC3 8.0 RMLD_SALTY
72 HHSearch 66.1233% -1 - C2 -1KC1 - RMLD_SALTY -
79 Fugue 65.9534% 18 - C2 -1N2S - RMLD_SALTY -
14 PsiBlast_PDB 62.6428% -63 - C2 -2YDY - MAT2B_HUMAN -