@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PF00303_TYSY_L: (2014-09-04 )
MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSKGFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTSKGDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVNDGKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDFDMKDIKLLNYDPYPAIKAPVAV

Atome Classification :

(54 SA) .........10........20........30..-......40..-......50........60........70........80........90........100.......110.......120.......130.......140.......150..--.------------------------...--------.160.......170.......180.......190.......200..--..---..---.210.......220.......230.......240.......250.......260.......270.......280.......290..--------..---...300.......310....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVAV
33 PsiBlast_CBE 97.94100%-125 - C8 -1THY TYSY_LACCA A:[1-316] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVAV
28 PsiBlast_CBE 97.90100%-127 - C8 -3BYX TYSY_LACCA A:[1-315] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQ--PEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVA-
47 PsiBlast_CBE 97.7199%-123 - C8 -1BP6 TYSY_LACCA A:[1-316] MLEQPYLDLAKKVLDEGHFKPDITHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRTLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVAV
44 PsiBlast_CBE 97.6999%-121 - C8 -1JMH TYSY_LACCA A:[1-316] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFIIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVAV
31 PsiBlast_CBE 97.53100%-121 - C8 -1TSM TYSY_LACCA A:[1-316] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVAV
1 PsiBlast_PDB 97.5099%-123 - C8 -1TSY TYSY_LACCA A:[1-316] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRKLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVAV
32 PsiBlast_CBE 97.36100%-125 - C8 -1TSL TYSY_LACCA A:[1-316] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVAV
12 PsiBlast_PDB 97.2399%-122 - C8 -1BO8 TYSY_LACCA A:[1-316] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSTRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVAV
19 PsiBlast_PDB 97.2299%-126 - C8 -1JMF TYSY_LACCA A:[1-316] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFAIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVAV
14 PsiBlast_PDB 97.2199%-124 - C8 -1NJD TYSY_LACCA A:[1-316] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFDIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVAV
17 PsiBlast_PDB 97.0699%-125 - C8 -1JMG TYSY_LACCA A:[1-316] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFGIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVAV
43 PsiBlast_CBE 97.0499%-123 - C8 -1BP0 TYSY_LACCA A:[1-316] MLEQPYLDLAKKVLDEGHFKPDITHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVAV
13 PsiBlast_PDB 96.9699%-124 - C8 -1NJC TYSY_LACCA A:[1-316] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFDIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVAV
37 PsiBlast_CBE 96.8699%-122 - C8 -2G89 TYSY_LACCA A:[1-316] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLAVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVAV
38 PsiBlast_CBE 96.8199%-123 - C8 -1TVV TYSY_LACCA A:[1-316] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFCIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVAV
11 PsiBlast_PDB 96.8199%-122 - C8 -1BO7 TYSY_LACCA A:[1-316] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRTLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVAV
39 PsiBlast_CBE 96.8099%-125 - C8 -1NJB TYSY_LACCA A:[1-316] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFCIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVAV
34 PsiBlast_CBE 96.80100%-123 - C8 -1NJE TYSY_LACCA A:[1-316] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVAV
46 PsiBlast_CBE 96.7499%-122 - C8 -1BPJ TYSY_LACCA A:[1-316] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSTTLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVAV
42 PsiBlast_CBE 96.6999%-122 - C8 -1VZB TYSY_LACCA A:[1-316] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSQLLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKAPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVAV
45 PsiBlast_CBE 96.6499%-119 - C8 -1VZA TYSY_LACCA A:[1-316] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSDLLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKAPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVAV
41 PsiBlast_CBE 96.6099%-127 - C8 -1VZC TYSY_LACCA A:[1-316] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSQLLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKAPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVAV
20 PsiBlast_PDB 96.5099%-125 - C8 -1TVU TYSY_LACCA A:[1-316] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFAIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVAV
36 PsiBlast_CBE 96.4999%-119 - C8 -2G8A TYSY_LACCA A:[1-316] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLMVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVAV
15 PsiBlast_PDB 96.4399%-122 - C8 -1TSV TYSY_LACCA A:[1-316] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRALIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVAV
10 PsiBlast_PDB 96.4399%-124 - C8 -1TSX TYSY_LACCA A:[1-316] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRELIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVAV
7 PsiBlast_PDB 96.3299%-119 - C8 -2G86 TYSY_LACCA A:[1-316] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLFVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVAV
35 PsiBlast_CBE 96.18100%-121 - C8 -1LCE TYSY_LACCA A:[1-316] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVAV
40 PsiBlast_CBE 96.1799%-121 - C8 -1NJA TYSY_LACCA A:[1-316] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFCIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVAV
24 PsiBlast_CBE 96.09100%-130 - C8 -3IJZ TYSY_LACCA A:[1-312] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKA----
23 PsiBlast_CBE 96.09100%-127 - C8 -3IK0 TYSY_LACCA A:[1-312] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKA----
22 PsiBlast_CBE 95.80100%-129 - C8 -3IK1 TYSY_LACCA A:[1-311] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIK-----
29 PsiBlast_CBE 95.70100%-123 - C8 -3BNZ TYSY_LACCA A:[1-314] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHG-DMT-FGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPV--
5 PsiBlast_PDB 95.68100%-124 - C8 -1TDC TYSY_LACCA A:[1-315] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVA-
30 PsiBlast_CBE 95.67100%-118 - C8 -2TDM TYSY_LACCA A:[1-316] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVAV
18 PsiBlast_PDB 95.6799%-119 - C8 -2G8D TYSY_LACCA A:[1-316] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLWVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVAV
27 PsiBlast_CBE 95.64100%-128 - C8 -3BZ0 TYSY_LACCA A:[1-312] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEY---DMTDFGHRSQK---FAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKA----
9 PsiBlast_PDB 95.4799%-120 - C8 -1TVW TYSY_LACCA A:[1-316] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFSIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVAV
26 PsiBlast_CBE 95.38100%-123 - C8 -3C06 TYSY_LACCA A:[1-316] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGP------------PEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPR-APTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVAV
8 PsiBlast_PDB 95.0699%-121 - C8 -1JMI TYSY_LACCA A:[1-316] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFSIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVAV
4 PsiBlast_PDB 94.95100%-122 - C8 -1TDB TYSY_LACCA A:[1-315] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVA-
6 PsiBlast_PDB 94.93100%-121 - C8 -2TDD TYSY_LACCA A:[1-315] MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAPVA-
25 PsiBlast_CBE 94.51100%-133 - C8 -3C0A TYSY_LACCA A:[1-313] MLEQPYLDLAKKVLDEGHFKP----TGTYSIFG-HQMRFDLSKG-FPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYH--------------------YHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWH--T------------------------SKG--------DTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQF--YV---ND---GKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDF--------DM---KDIKLLNYDPYPAIKAP---
63 HHSearch 87.5564%-123 - C8 -4DQ1 TYSY_STAAM A:[8-317] -FDAAYHSLCEEVLEIGNTRNDRTNTGTISKFG-HQLRFDLSKG-FPLLTTKKVSFKLVATELLWFIKGDTNIQYLLKYNNNIWNEWAFENYIKSDEYNGPDMTDFGHRALSDPEFNEQYKEQMKQFKQRILEDDTFAKQFGDLGNVYGKQWRDWV--D------------------------KDG--------NHFDQLKTVIEQIKHNPDSRRHIVSAWNPTEIDTMALPPCHTMFQF--YV---QD---GKLSCQLYQRSADIFLGVPFNIASYALLTHLIAKECGLEVGEFVHTFGDAHIYSNHIDAIQTQLARESFNPPTLKINSD-KSIFDI--------NY---EDLEIVDYESHPAIKA----
50 PsiBlast_CBE 78.8973% -73 - C8 -3UWL TYSY_ENTFA D:[1-315] -MEEAYLALGKKILEEGHFKEDRTGTGTYSLFG-YQMRFDLAKG-FPLLTTKRVPFGLIKSELLWFLKGDTNIRYLLERNNHIWDEWAFERYVKSADYQGPDMTDFGHRVLQDPAFAEQYKEEHQKFCDAILNDAEFAEKYGELGNIYGAQWRHWE--T------------------------KDG--------SFIDQLANVIEMIKTNPDSRRLIVSAWNPEDVPSMALPP-HTMFQF--YV---NE---GKLSCQLYQRSADVFLGVPFNIASYALLTHLIAHETGLEVGEFVHTLGDAHLYQNHVEQMQEQLSREVRSFPTLVLNPDKASVFDF--------DM---EDIKVEGYDPHPTIKAPIAV
51 PsiBlast_CBE 78.2373% -73 - C8 -3UWL TYSY_ENTFA B:[1-315] -MEEAYLALGKKILEEGHFKEDRTGTGTYSLFG-YQMRFDLAKG-FPLLTTKRVPFGLIKSELLWFLKGDTNIRYLLERNNHIWDEWAFERYVKSADYQGPDMTDFGHRVLQDPAFAEQYKEEHQKFCDAILNDAEFAEKYGELGNIYGAQWRHWE--T------------------------KDG--------SFIDQLANVIEMIKTNPDSRRLIVSAWNPEDVPSMALPP-HTMFQF--YV---NE---GKLSCQLYQRSADVFLGVPFNIASYALLTHLIAHETGLEVGEFVHTLGDAHLYQNHVEQMQEQLSREVRSFPTLVLNPDKASVFDF--------DM---EDIKVEGYDPHPTIKAPIAV