@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : CDK9_HUMAN: (2013-07-19 )
MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF

Atome Classification :

(99 SA) .........10........20..-......30........--40........50........60........70........80........90........100.......110..-.------....120.......130.......140.......150.....----..-160.......170.......180..-.....190.......200.......210.......220..-----------..-...230.-------.----.....240.......250.....-------..260...---.-.----.---.270.-.--......280--.......290.......300.......310....--...320.......330.......340.......350.......360.......370
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MAKQYDSVECPFCDEVSKYEKLA-KIGQGTFGEVFKARHR--KTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLL-S------NVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLI----TR-DGVLKLADFGLARAFSLAKNSQPNR-YTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWT-----------RS-PIMQGNT-------E----QHQLALISQLCGSITPEVWPNVD-------NYELYEKL---E-L----V---KGQ-K-R--KVKDRLKAY--VRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFW--SDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF
4 PsiBlast_PDB 95.5099%-125 - C1 -3MIA CDK9_HUMAN A:[8-340] -------VECPFCDEVSKYEKLA-KIGQGTFGEVFKARHR--KTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRT--------KGSIYLVFDFCEHDLAGLL-S------NVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLI----TR-DGVLKLADFGLARAFSLAKNSQPNR-YTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWT-----------RS-PIMQGNT-------E----QHQLALISQLCGSITPEVWPNVD-------NYELYEKL---E-L----V---KGQ-K-R--KVKDRLKAY--VRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFW--SDPMPSDLKGMLSTHLTSMFEYLA--------------------------------
13 PsiBlast_PDB 95.0799%-131 - C1 -4BCG CDK9_HUMAN A:[8-328] ------SVECPFCDEVSKYEKLA-KIGQGTFGEVFKARHR--KTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRT--------KGSIYLVFDFCEHDLAGLL-S------NVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLI----TR-DGVLKLADFGLARAFSLAKNSQPNR-YTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWT-----------RS-PIMQGNT-------E----QHQLALISQLCGSITPEVWPNVD-------NYELYEKL---E-L----V---KGQ-K-R--KVKDRLKAY--VRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFW--SDPMPSDLKGM---------------------------------------------
5 PsiBlast_PDB 94.8799%-136 - C1 -3BLQ CDK9_HUMAN A:[8-326] ------SVECPFCDEVSKYEKLA-KIGQGTFGEVFKARHR--KTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRT----------SIYLVFDFCEHDLAGLL-S------NVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLI----TR-DGVLKLADFGLARAFS-------NR-YTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWT-----------RS-PIMQGNT-------E----QHQLALISQLCGSITPEVWPNVD-------NYELYEKL---E-L----V-------------VKDRLKAY--VRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFW--SDPMPSDLK-----------------------------------------------
7 PsiBlast_PDB 92.9999%-123 - C1 -3MY1 CDK9_HUMAN A:[7-328] -----DSVECPFCDEVSKYEKLA-KIGQGTFGEVFKARHR--KTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTK-------KGSIYLVFDFCEHDLAGLL-S------NVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLI----TR-DGVLKLADFGLARAFSLAKNSQPNR-YTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWT-----------RS-PIMQGNT-------E----QHQLALISQLCGSITPEVWPNVD-------NYELYEKL---E-L----V---KGQ-K-R--KVKDRLKAY--VRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFW--SDPMPSDLKGM---------------------------------------------
8 PsiBlast_PDB 92.5199%-129 - C1 -3LQ5 CDK9_HUMAN A:[7-328] -----DSVECPFCDEVSKYEKLA-KIGQ--FGEVFKARHR--KTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRT--------KGSIYLVFDFCEHDLAGLL-S------NVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLI----TR-DGVLKLADFGLARAFSLA----PNR-YTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWT-----------RS-PIMQGNT-------E----QHQLALISQLCGSITPEVWPNVD-------NYELYEKL---E-L----V---KGQ-K-R--KVKDRLKAY--VRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFW--SDPMPSDLKGM---------------------------------------------
12 PsiBlast_PDB 92.1499%-126 - C1 -4BCJ CDK9_HUMAN A:[7-327] -----DSVECPFCDEVSKYEKLA-KIGQGTFGEVFKARHR--KTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTK-------KGSIYLVFDFCEHDLAGLL-S------NVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLI----TR-DGVLKLADFGLARAFSLA----PNR-YTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWT-----------RS-PIMQGNT-------E----QHQLALISQLCGSITPEVWPNVD-------NYELYEKL---E-L----V---KGQ-K-R--KVKDRLKAY--VRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFW--SDPMPSDLKG----------------------------------------------
6 PsiBlast_PDB 92.1099%-128 - C1 -3BLR CDK9_HUMAN A:[8-327] ------SVECPFCDEVSKYEKLA-KIGQGTFGEVFKARHR--KTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRT----------SIYLVFDFCEHDLAGLL-S------NVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLI----TR-DGVLKLADFGLARAFSLA----PNR-YTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWT-----------RS-PIMQGNT-------E----QHQLALISQLCGSITPEVWPNVD-------NYELYEKL---E-L----V---K---------VKDRLKAY--VRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFW--SDPMPSDLKG----------------------------------------------
11 PsiBlast_PDB 92.0699%-127 - C1 -4BCI CDK9_HUMAN A:[6-327] ----YDSVECPFCDEVSKYEKLA-KIGQGTFGEVFKARHR--KTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRT---------GSIYLVFDFCEHDLAGLL-S------NVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLI----TR-DGVLKLADFGLARAFSLA----PNR-YTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWT-----------RS-PIMQGNT-------E----QHQLALISQLCGSITPEVWPNVD-------NYELYEKL---E-L----V---KGQ-K-R--KVKDRLKAY--VRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFW--SDPMPSDLKG----------------------------------------------
9 PsiBlast_PDB 91.4799%-136 - C1 -3TNH CDK9_HUMAN A:[9-329] -------VECPFCDEVSKYEKLA-KIGQGTFGEVFKARHR--KTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRT----------SIYLVFDFCEHDLAGLL-S------NVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLI----TR-DGVLKLADFGLARAFS-------NR-YTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWT-----------RS-PIMQGNT-------E----QHQLALISQLCGSITPEVWPNVD-------N------------------------------KVKDRLKAY--VRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFW--SDPMPSDLKGML--------------------------------------------
131 HHSearch 66.8341%-113 - C1 -3NIZ ? A:[19-307] --------------LMEKYQKLE-KVGEGTYGVVYKAKDS---QGRIVALKRIR------GIPSTAIREISLLKELHHPNIVSLIDVIHSE--------RCLTLVFEFMEKDLKKVL-D------ENKTGLQDSQIKIYLYQLLRGVAHCHQHRILHRDLKPQNLLI----NS-DGALKLADFGLARAFGI----PVR----HEVVTLWYRAPDVLMGSKKYSTSVDIWSIGCIFAEMIT-----------GK-PLFPGVT-------D----DDQLPKIFSILGTPNPREWPQVQ-------ELPLWKQR---T-F----Q---VFE-K-K--PWSSIIPGF----CQEGIDLLSNMLCFDPNKRISARDAMNHPYFK--DL------------------------------------------------------
81 PsiBlast_CBE 66.5339%-112 - C1 -3R8P CDK2_HUMAN A:[12-302] ------------------FQKVE-KIGEGTYGVVYKARNK--LTGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT--------ENKLYLVFEFLHQDLKKFMDA------SALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-EGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-----------RR-ALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S-F----P---KWA-R-Q--DFSKVVPPL--DED--GRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVP---------------------------------------------------
122 HHSearch 66.4531%-103 - C1 -3N9X ? A:[24-373] --------------VPDNYIIKH-LIGRGSYGYVYLAYDK--NTEKNVAIKKVNRMFEDLIDCKRILREITILNRLKSDYIIRLYDLIIPDDLL---KFDELYIVLEIADSDLKKLF-K------TP-IFLTEEHIKTILYNLLLGENFIHESGIIHRDLKPANCLL----NQ-DCSVKVCDFGLARTI--------------HVVTRWYRAPELILLQENYTKSIDIWSTGCIFAELLNMLQSHINDPTNRF-PLFPGSSCFPHEKSN----RDQLNIIFNIIGTPTEDDLKNIN-------KPEVIKYI---KLF----P---HRK-P-I--NLKQKYPSI----SDDGINLLESMLKFNPNKRITIDQALDHPYLK--DVRKKKL-------------------------------------------------
84 PsiBlast_CBE 66.3939%-111 - C1 -3R83 CDK2_HUMAN A:[12-302] ------------------FQKVE-KIGEGTYGVVYKARNK--LTGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT--------ENKLYLVFEFLHQDLKKFMDA------SALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-EGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-----------RR-ALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S-F----P---KWA-R-Q--DFSKVVPPL--DED--GRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVP---------------------------------------------------
85 PsiBlast_CBE 66.3539%-112 - C1 -3R7Y CDK2_HUMAN A:[12-302] ------------------FQKVE-KIGEGTYGVVYKARNK--LTGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT--------ENKLYLVFEFLHQDLKKFMDA------SALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-EGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-----------RR-ALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S-F----P---KWA-R-Q--DFSKVVPPL--DED--GRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVP---------------------------------------------------
91 PsiBlast_CBE 66.1839%-111 - C1 -3R71 CDK2_HUMAN A:[12-302] ------------------FQKVE-KIGEGTYGVVYKARNK--LTGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT--------ENKLYLVFEFLHQDLKKFMDA------SALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-EGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-----------RR-ALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S-F----P---KWA-R-Q--DFSKVVPPL--DED--GRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVP---------------------------------------------------
53 PsiBlast_CBE 66.1839%-112 - C1 -3S0O CDK2_HUMAN A:[12-302] ------------------FQKVE-KIGEGTYGVVYKARNK--LTGEVVALKKIRL---TEGVPSTAIREISLLKELNHPNIVKLLDVIHT--------ENKLYLVFEFLHQDLKKFMDA------SALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-EGAIKLADF--ARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-----------RR-ALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S-F----P---KWA-R-Q--DFSKVVPPL--DED--GRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVP---------------------------------------------------
78 PsiBlast_CBE 66.1139%-113 - C1 -3R8Z CDK2_HUMAN A:[12-302] ------------------FQKVE-KIGEGTYGVVYKARNK--LTGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT--------ENKLYLVFEFLHQDLKKFMDA------SALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-EGAIKLADFGLARAFGVP---------THEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-----------RR-ALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S-F----P---KWA-R-Q--DFSKVVPPL--DED--GRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVP---------------------------------------------------
59 PsiBlast_CBE 66.0339%-111 - C1 -3RPO CDK2_HUMAN A:[12-302] ------------------FQKVE-KIGEGTYGVVYKARNK--LTGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT--------ENKLYLVFEFLHQDLKKFMDA------SALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-EGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-----------RR-ALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S-F----P---KWA-R-Q--DFSKVVPPL--DED--GRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVP---------------------------------------------------
72 PsiBlast_CBE 65.7939%-109 - C1 -3RAI CDK2_HUMAN A:[12-302] ------------------FQKVE-KIGEGTYGVVYKARNK--LTGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT--------ENKLYLVFEFLHQDLKKFMDA------SALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-EGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-----------RR-ALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S-F----P---KWA-R-Q--DFSKVVPPL--DED--GRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVP---------------------------------------------------
89 PsiBlast_CBE 65.7639%-112 - C1 -3R7E CDK2_HUMAN A:[12-302] ------------------FQKVE-KIGEGTYGVVYKARNK--LTGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT--------ENKLYLVFEFLHQDLKKFMDA------SALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-EGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-----------RR-ALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S-F----P---KWA-R-Q--DFSKVVPPL--DED--GRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVP---------------------------------------------------
96 PsiBlast_CBE 65.5939%-109 - C1 -3R1Q CDK2_HUMAN A:[12-302] ------------------FQKVE-KIGEGTYGVVYKARNK--LTGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT--------ENKLYLVFEFLHQDLKKFMDA------SALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-EGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-----------RR-ALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S-F----P---KWA-R-Q--DFSKVVPPL--DED--GRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVP---------------------------------------------------
54 PsiBlast_CBE 65.5839%-110 - C1 -3S00 CDK2_HUMAN A:[12-302] ------------------FQKVE-KIGEGTYGVVYKARNK--LTGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT--------ENKLYLVFEFLHQDLKKFMDA------SALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-EGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-----------RR-ALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S-F----P---KWA-R-Q--DFSKVVPPL--DED--GRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVP---------------------------------------------------
98 PsiBlast_CBE 65.5139%-109 - C1 -3QZH CDK2_HUMAN A:[12-302] ------------------FQKVE-KIGEGTYGVVYKARNK--LTGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT--------ENKLYLVFEFLHQDLKKFMDA------SALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-EGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-----------RR-ALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S-F----P---KWA-R-Q--DFSKVVPPL--DED--GRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVP---------------------------------------------------
26 PsiBlast_CBE 65.4440%-117 - C1 -1V0P CDC2H_PLAFK A:[1-284] ---------------MEKYHGLE-KIGEGTYGVVYKAQNN---YGETFALKKIRLEKEDEGIPSTTIREISILKELKHSNIVKLYDVIHTKKR--------LVLVFEHLDQDLKKLL-D------VCEGGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLI----NR-EGELKIADFGLARAFG--------------IVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVN-----------GT-PLFPGVS-------E----ADQLMRIFRILGTPNSKNWPNVTELPKYDPNFTVYEPLPWES-F----L---KG-------------------LDESGIDLLSKMLKLDPNQRITAKQALEHAYF-----------------------------------------------------------
51 PsiBlast_CBE 65.3639%-106 - C1 -3SQQ CDK2_HUMAN A:[12-302] ------------------FQKVE-KIGEGTYGVVYKARNK--LTGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT--------ENKLYLVFEFLHQDLKKFMDA------SALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-EGAIKLADFGLAR------RT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-----------RR-ALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S-F----P---KWA-R-Q--DFSKVVPPL--DED--GRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVP---------------------------------------------------
94 PsiBlast_CBE 65.2939%-110 - C1 -3R1Y CDK2_HUMAN A:[12-302] ------------------FQKVE-KIGEGTYGVVYKARNK--LTGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT--------ENKLYLVFEFLHQDLKKFMDA------SALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-EGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-----------RR-ALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S-F----P---KWA-R-Q--DFSKVVPPL--DED--GRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVP---------------------------------------------------
63 PsiBlast_CBE 65.2739%-113 - C1 -3RM7 CDK2_HUMAN A:[12-302] ------------------FQKVE-KIGEGTYGVVYKARNK--LTGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT--------ENKLYLVFEFLHQDLKKFMDA------SALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-EGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-----------RR-ALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S-F----P---KWA-R-Q--DFSKVVPPL--DED--GRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVP---------------------------------------------------
79 PsiBlast_CBE 65.2639%-111 - C1 -3R8V CDK2_HUMAN A:[12-302] ------------------FQKVE-KIGEGTYGVVYKARNK--LTGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT--------ENKLYLVFEFLHQDLKKFMDA------SALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-EGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-----------RR-ALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S-F----P---KWA-R-Q--DFSKVVPPL--DED--GRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVP---------------------------------------------------
95 PsiBlast_CBE 65.2239%-109 - C1 -3R1S CDK2_HUMAN A:[12-302] ------------------FQKVE-KIGEGTYGVVYKARNK--LTGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT--------ENKLYLVFEFLHQDLKKFMDA------SALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-EGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-----------RR-ALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S-F----P---KWA-R-Q--DFSKVVPPL--DED--GRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVP---------------------------------------------------
73 PsiBlast_CBE 65.1539%-112 - C1 -3RAH CDK2_HUMAN A:[12-302] ------------------FQKVE-KIGEGTYGVVYKARNK--LTGEVVALKKIR--------PSTAIREISLLKELNHPNIVKLLDVIHT--------ENKLYLVFEFLHQDLKKFMDA------SALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-EGAIKLADFGLARAFGV-------------VVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-----------RR-ALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S-F----P---KWA-R-Q--DFSKVVPPL--DED--GRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVP---------------------------------------------------
92 PsiBlast_CBE 65.1439%-108 - C1 -3R6X CDK2_HUMAN A:[12-302] ------------------FQKVE-KIGEGTYGVVYKARNK--LTGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT--------ENKLYLVFEFLHQDLKKFMDA------SALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-EGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-----------RR-ALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S-F----P---KWA-R-Q--DFSKVVPPL--DED--GRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVP---------------------------------------------------
97 PsiBlast_CBE 65.0939%-110 - C1 -3QZI CDK2_HUMAN A:[12-302] ------------------FQKVE-KIGEGTYGVVYKARNK--LTGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT--------ENKLYLVFEFLHQDLKKFMDA------SALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-EGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-----------RR-ALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S-F----P---KWA-R-Q--DFSKVVPPL--DED--GRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVP---------------------------------------------------
23 PsiBlast_CBE 65.0940%-118 - C1 -1V0O CDC2H_PLAFK B:[3-284] -----------------KYHGLE-KIGEGTYGVVYKAQNN---YGETFALKKIRL----------TIREISILKELKHSNIVKLYDVIHTKKR--------LVLVFEHLDQDLKKLL-D------VCEGGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLI----NR-EGELKIADFGLARAFGIP----VRK-YTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVN-----------GT-PLFPGVS-------E----ADQLMRIFRILGTPNSKNWPNVTELPKYDPNFTVYEPLPWES-F----L---KG-------------------LDESGIDLLSKMLKLDPNQRITAKQALEHAYF-----------------------------------------------------------
102 PsiBlast_CBE 65.0139%-109 - C1 -3QXO CDK2_HUMAN A:[12-302] ------------------FQKVE-KIGEGTYGVVYKARNK--LTGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT--------ENKLYLVFEFLHQDLKKFMDA------SALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-EGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-----------RR-ALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S-F----P---KWA-R-Q--DFSKVVPPL--DED--GRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVP---------------------------------------------------
86 PsiBlast_CBE 64.9939%-109 - C1 -3R7V CDK2_HUMAN A:[12-302] ------------------FQKVE-KIGEGTYGVVYKARNK--LTGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT--------ENKLYLVFEFLHQDLKKFMDA------SALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-EGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-----------RR-ALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S-F----P---KWA-R-Q--DFSKVVPPL--DED--GRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVP---------------------------------------------------
93 PsiBlast_CBE 64.9539%-109 - C1 -3R28 CDK2_HUMAN A:[12-302] ------------------FQKVE-KIGEGTYGVVYKARNK--LTGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT--------ENKLYLVFEFLHQDLKKFMDA------SALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-EGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-----------RR-ALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S-F----P---KWA-R-Q--DFSKVVPPL--DED--GRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVP---------------------------------------------------
88 PsiBlast_CBE 64.8339%-112 - C1 -3R7I CDK2_HUMAN A:[12-302] ------------------FQKVE-KIGEGTYGVVYKARNK--LTGEVVALKKIR--------PSTAIREISLLKELNHPNIVKLLDVIHT--------ENKLYLVFEFLHQDLKKFMDA------SALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-EGAIKLADFGLARAFGV-------------VVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-----------RR-ALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S-F----P---KWA-R-Q--DFSKVVPPL--DED--GRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVP---------------------------------------------------
58 PsiBlast_CBE 64.8239%-112 - C1 -3RPR CDK2_HUMAN A:[12-302] ------------------FQKVE-KIGEGTYGVVYKARNK--LTGEVVALKKIR--------PSTAIREISLLKELNHPNIVKLLDVIHT--------ENKLYLVFEFLHQDLKKFMDA------SALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-EGAIKLADFGLARAFGV-------------VVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-----------RR-ALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S-F----P---KWA-R-Q--DFSKVVPPL--DED--GRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVP---------------------------------------------------
57 PsiBlast_CBE 64.7839%-109 - C1 -3RPV CDK2_HUMAN A:[12-302] ------------------FQKVE-KIGEGTYGVVYKARNK--LTGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT--------ENKLYLVFEFLHQDLKKFMDA------SALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-EGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-----------RR-ALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S-F----P---KWA-R-Q--DFSKVVPPL--DED--GRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVP---------------------------------------------------
90 PsiBlast_CBE 64.7139%-109 - C1 -3R73 CDK2_HUMAN A:[12-302] ------------------FQKVE-KIGEGTYGVVYKARNK--LTGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT--------ENKLYLVFEFLHQDLKKFMDA------SALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-EGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-----------RR-ALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S-F----P---KWA-R-Q--DFSKVVPPL--DED--GRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVP---------------------------------------------------
80 PsiBlast_CBE 64.7139%-108 - C1 -3R8U CDK2_HUMAN A:[12-302] ------------------FQKVE-KIGEGTYGVVYKARNK--LTGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT--------ENKLYLVFEFLHQDLKKFMDA------SALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-EGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-----------RR-ALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S-F----P---KWA-R-Q--DFSKVVPPL--DED--GRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVP---------------------------------------------------
50 PsiBlast_CBE 64.7139%-110 - C1 -4EZ3 CDK2_HUMAN A:[12-302] ------------------FQKVE-KIGEGTYGVVYKARNK--LTGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT--------ENKLYLVFEFLHQDLKKFMDA------SALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-EGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-----------RR-ALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S-F----P---KWA-R-Q--DFSKVVPPL--DED--GRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVP---------------------------------------------------
100 PsiBlast_CBE 64.6839%-108 - C1 -3QZF CDK2_HUMAN A:[12-302] ------------------FQKVE-KIGEGTYGVVYKARNK--LTGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT--------ENKLYLVFEFLHQDLKKFMDA------SALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-EGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-----------RR-ALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S-F----P---KWA-R-Q--DFSKVVPPL--DED--GRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVP---------------------------------------------------
60 PsiBlast_CBE 64.5939%-108 - C1 -3ROY CDK2_HUMAN A:[12-302] ------------------FQKVE-KIGEGTYGVVYKARNK--LTGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT--------ENKLYLVFEFLHQDLKKFMDA------SALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-EGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-----------RR-ALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S-F----P---KWA-R-Q--DFSKVVPPL--DED--GRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVP---------------------------------------------------