@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu12980: (2016-06-20 )
MKIIRIETSRIAVPLTKPFKTALRTVYTAESVIVRITYDSGAVGWGEAPPTLVITGDSMDSIESAIHHVLKPALLGKSLAGYEAILHDIQHLLTGNMSAKAAVEMALYDGWAQMCGLPLYQMLGGYRDTLETDYTVSVNSPEEMAADAENYLKQGFQTLKIKVGKDDIATDIARIQEIRKRVGSAVKLRLDANQGWRPKEAVTAIRKMEDAGLGIELVEQPVHKDDLAGLKKVTDATDTPIMADESVFTPRQAFEVLQTRSADLINIKLMKAGGISGAEKINAMAEACGVECMVGSMIETKLGITAAAHFAASKRNITRFDFDAPLMLKTDVFNGGITYSGSTISMPGKPGLGIIGAALLKGEKEQ

Atome Classification :

(24 SA) .........10........20........30........40........50..-.-.....60........70........80........90........100.......110.......120.....-.-.130.......140.......150.......160.......170.......180.......190.......200.......210--.--......220.......230.......240.......250.......260.......270.......280.......290.......300.......310.......320.......330......-.340......-..350.......360....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MKIIRIETSRIAVPLTKPFKTALRTVYTAESVIVRITYDSGAVGWGEAPPTLV-I-TGDSMDSIESAIHHVLKPALLGKSLAGYEAILHDIQHLLTGNMSAKAAVEMALYDGWAQMCGLPLYQMLGGYR-D-TLETDYTVSVNSPEEMAADAENYLKQGFQTLKIKVGKDDIATDIARIQEIRKRVGSAVKLRLDANQGWRPKEAVTAIRKMEDAG--L--GIELVEQPVHKDDLAGLKKVTDATDTPIMADESVFTPRQAFEVLQTRSADLINIKLMKAGGISGAEKINAMAEACGVECMVGSMIETKLGITAAAHFAASKRNITRFDFDAPLMLKTDVFNGGIT-YSG-STISMP-GKPGLGIIGAALLKGEKEQ
29 PsiBlast_CBE 89.17100% -83 - C1 -1JPM AEEP_BACSU C:[1-358] MKIIRIETSRIAVPLTKPFKTALRTVYTAESVIVRITYDSGAVGWGEAPPTLV-I-TGDSMDSIESAIHHVLKPALLGKSLAGYEAILHDIQHLLTGNMSAKAAVEMALYDGWAQMCGLPLYQMLGGYR-D-TLETDYTVSVNSPEEMAADAENYLKQGFQTLKIKVGKDDIATDIARIQEIRKRVGSAVKLRLDANQGWRPKEAVTAIRKMEDAG--L--GIELVEQPVHKDDLAGLKKVTDATDTPIMADESVFTPRQAFEVLQTRSADLINIKLMKAGGISGAEKINAMAEACGVECMVGSMIETKLGITAAAHFAASKRNITRFDFDAPLMLKTDVFNGGIT-YSG-STISMP-GKPGLGIIGAA--------
1 PsiBlast_PDB 88.62100% -81 - C1 -1JPM AEEP_BACSU A:[1-359] MKIIRIETSRIAVPLTKPFKTALRTVYTAESVIVRITYDSGAVGWGEAPPTLV-I-TGDSMDSIESAIHHVLKPALLGKSLAGYEAILHDIQHLLTGNMSAKAAVEMALYDGWAQMCGLPLYQMLGGYR-D-TLETDYTVSVNSPEEMAADAENYLKQGFQTLKIKVGKDDIATDIARIQEIRKRVGSAVKLRLDANQGWRPKEAVTAIRKMEDAG--L--GIELVEQPVHKDDLAGLKKVTDATDTPIMADESVFTPRQAFEVLQTRSADLINIKLMKAGGISGAEKINAMAEACGVECMVGSMIETKLGITAAAHFAASKRNITRFDFDAPLMLKTDVFNGGIT-YSG-STISMP-GKPGLGIIGAAL-------
28 PsiBlast_CBE 88.39100% -81 - C1 -1JPM AEEP_BACSU D:[1-358] MKIIRIETSRIAVPLTKPFKTALRTVYTAESVIVRITYDSGAVGWGEAPPTLV-I-TGDSMDSIESAIHHVLKPALLGKSLAGYEAILHDIQHLLTGNMSAKAAVEMALYDGWAQMCGLPLYQMLGGYR-D-TLETDYTVSVNSPEEMAADAENYLKQGFQTLKIKVGKDDIATDIARIQEIRKRVGSAVKLRLDANQGWRPKEAVTAIRKMEDAG--L--GIELVEQPVHKDDLAGLKKVTDATDTPIMADESVFTPRQAFEVLQTRSADLINIKLMKAGGISGAEKINAMAEACGVECMVGSMIETKLGITAAAHFAASKRNITRFDFDAPLMLKTDVFNGGIT-YSG-STISMP-GKPGLGIIGAA--------
30 PsiBlast_CBE 87.29100% -80 - C1 -1JPM AEEP_BACSU B:[1-359] MKIIRIETSRIAVPLTKPFKTALRTVYTAESVIVRITYDSGAVGWGEAPPTLV-I-TGDSMDSIESAIHHVLKPALLGKSLAGYEAILHDIQHLLTGNMSAKAAVEMALYDGWAQMCGLPLYQMLGGYR-D-TLETDYTVSVNSPEEMAADAENYLKQGFQTLKIKVGKDDIATDIARIQEIRKRVGSAVKLRLDANQGWRPKEAVTAIRKMEDAG--L--GIELVEQPVHKDDLAGLKKVTDATDTPIMADESVFTPRQAFEVLQTRSADLINIKLMKAGGISGAEKINAMAEACGVECMVGSMIETKLGITAAAHFAASKRNITRFDFDAPLMLKTDVFNGGIT-YSG-STISMP-GKPGLGIIGAAL-------
21 PsiBlast_CBE 84.45100% -76 - C1 -1TKK AEEP_BACSU H:[1-359] MKIIRIETSRIAVPLTKPFKTALRTVYTAESVIVRITYDSGAVGWGEAPPTLV-I-TGDSMDSIESAIHHVLKPALLGKSLAGYEAILHDIQHLLTGNMSAKAAVEMALYDGWAQMCGLPLYQMLGGYR-D-TLETDYTVSVNSPEEMAADAENYLKQGFQTLKIKVGKDDIATDIARIQEIRKRVGSAVKLRLDANQGWRPKEAVTAIRKMEDAG--L--GIELVEQPVHKDDLAGLKKVTDATDTPIMADESVFTPRQAFEVLQTRSADLINIKLMKAGGISGAEKINAMAEACGVECMVGSMIETKLGITAAAHFAASKRNITRFDFDAPLMLKTDVFNGGIT-YSG-STISMP-GKPGLGIIGAAL-------
2 PsiBlast_PDB 83.99100% -75 - C1 -1TKK AEEP_BACSU A:[1-359] MKIIRIETSRIAVPLTKPFKTALRTVYTAESVIVRITYDSGAVGWGEAPPTLV-I-TGDSMDSIESAIHHVLKPALLGKSLAGYEAILHDIQHLLTGNMSAKAAVEMALYDGWAQMCGLPLYQMLGGYR-D-TLETDYTVSVNSPEEMAADAENYLKQGFQTLKIKVGKDDIATDIARIQEIRKRVGSAVKLRLDANQGWRPKEAVTAIRKMEDAG--L--GIELVEQPVHKDDLAGLKKVTDATDTPIMADESVFTPRQAFEVLQTRSADLINIKLMKAGGISGAEKINAMAEACGVECMVGSMIETKLGITAAAHFAASKRNITRFDFDAPLMLKTDVFNGGIT-YSG-STISMP-GKPGLGIIGAAL-------
27 PsiBlast_CBE 83.98100% -77 - C1 -1TKK AEEP_BACSU B:[1-358] MKIIRIETSRIAVPLTKPFKTALRTVYTAESVIVRITYDSGAVGWGEAPPTLV-I-TGDSMDSIESAIHHVLKPALLGKSLAGYEAILHDIQHLLTGNMSAKAAVEMALYDGWAQMCGLPLYQMLGGYR-D-TLETDYTVSVNSPEEMAADAENYLKQGFQTLKIKVGKDDIATDIARIQEIRKRVGSAVKLRLDANQGWRPKEAVTAIRKMEDAG--L--GIELVEQPVHKDDLAGLKKVTDATDTPIMADESVFTPRQAFEVLQTRSADLINIKLMKAGGISGAEKINAMAEACGVECMVGSMIETKLGITAAAHFAASKRNITRFDFDAPLMLKTDVFNGGIT-YSG-STISMP-GKPGLGIIGAA--------
25 PsiBlast_CBE 83.92100% -76 - C1 -1TKK AEEP_BACSU D:[1-359] MKIIRIETSRIAVPLTKPFKTALRTVYTAESVIVRITYDSGAVGWGEAPPTLV-I-TGDSMDSIESAIHHVLKPALLGKSLAGYEAILHDIQHLLTGNMSAKAAVEMALYDGWAQMCGLPLYQMLGGYR-D-TLETDYTVSVNSPEEMAADAENYLKQGFQTLKIKVGKDDIATDIARIQEIRKRVGSAVKLRLDANQGWRPKEAVTAIRKMEDAG--L--GIELVEQPVHKDDLAGLKKVTDATDTPIMADESVFTPRQAFEVLQTRSADLINIKLMKAGGISGAEKINAMAEACGVECMVGSMIETKLGITAAAHFAASKRNITRFDFDAPLMLKTDVFNGGIT-YSG-STISMP-GKPGLGIIGAAL-------
26 PsiBlast_CBE 83.85100% -75 - C1 -1TKK AEEP_BACSU C:[1-359] MKIIRIETSRIAVPLTKPFKTALRTVYTAESVIVRITYDSGAVGWGEAPPTLV-I-TGDSMDSIESAIHHVLKPALLGKSLAGYEAILHDIQHLLTGNMSAKAAVEMALYDGWAQMCGLPLYQMLGGYR-D-TLETDYTVSVNSPEEMAADAENYLKQGFQTLKIKVGKDDIATDIARIQEIRKRVGSAVKLRLDANQGWRPKEAVTAIRKMEDAG--L--GIELVEQPVHKDDLAGLKKVTDATDTPIMADESVFTPRQAFEVLQTRSADLINIKLMKAGGISGAEKINAMAEACGVECMVGSMIETKLGITAAAHFAASKRNITRFDFDAPLMLKTDVFNGGIT-YSG-STISMP-GKPGLGIIGAAL-------
22 PsiBlast_CBE 83.69100% -75 - C1 -1TKK AEEP_BACSU G:[1-359] MKIIRIETSRIAVPLTKPFKTALRTVYTAESVIVRITYDSGAVGWGEAPPTLV-I-TGDSMDSIESAIHHVLKPALLGKSLAGYEAILHDIQHLLTGNMSAKAAVEMALYDGWAQMCGLPLYQMLGGYR-D-TLETDYTVSVNSPEEMAADAENYLKQGFQTLKIKVGKDDIATDIARIQEIRKRVGSAVKLRLDANQGWRPKEAVTAIRKMEDAG--L--GIELVEQPVHKDDLAGLKKVTDATDTPIMADESVFTPRQAFEVLQTRSADLINIKLMKAGGISGAEKINAMAEACGVECMVGSMIETKLGITAAAHFAASKRNITRFDFDAPLMLKTDVFNGGIT-YSG-STISMP-GKPGLGIIGAAL-------
23 PsiBlast_CBE 83.42100% -73 - C1 -1TKK AEEP_BACSU F:[1-358] MKIIRIETSRIAVPLTKPFKTALRTVYTAESVIVRITYDSGAVGWGEAPPTLV-I-TGDSMDSIESAIHHVLKPALLGKSLAGYEAILHDIQHLLTGNMSAKAAVEMALYDGWAQMCGLPLYQMLGGYR-D-TLETDYTVSVNSPEEMAADAENYLKQGFQTLKIKVGKDDIATDIARIQEIRKRVGSAVKLRLDANQGWRPKEAVTAIRKMEDAG--L--GIELVEQPVHKDDLAGLKKVTDATDTPIMADESVFTPRQAFEVLQTRSADLINIKLMKAGGISGAEKINAMAEACGVECMVGSMIETKLGITAAAHFAASKRNITRFDFDAPLMLKTDVFNGGIT-YSG-STISMP-GKPGLGIIGAA--------
24 PsiBlast_CBE 83.23100% -77 - C1 -1TKK AEEP_BACSU E:[1-359] MKIIRIETSRIAVPLTKPFKTALRTVYTAESVIVRITYDSGAVGWGEAPPTLV-I-TGDSMDSIESAIHHVLKPALLGKSLAGYEAILHDIQHLLTGNMSAKAAVEMALYDGWAQMCGLPLYQMLGGYR-D-TLETDYTVSVNSPEEMAADAENYLKQGFQTLKIKVGKDDIATDIARIQEIRKRVGSAVKLRLDANQGWRPKEAVTAIRKMEDAG--L--GIELVEQPVHKDDLAGLKKVTDATDTPIMADESVFTPRQAFEVLQTRSADLINIKLMKAGGISGAEKINAMAEACGVECMVGSMIETKLGITAAAHFAASKRNITRFDFDAPLMLKTDVFNGGIT-YSG-STISMP-GKPGLGIIGAAL-------
116 HHSearch 74.9499% -75 - C1 -1TKK AEEP_BACSU A:[1-359] MKIIRIETSRIAVPLTKPFKTALRTVYTAESVIVRITYDSGAVGWGEAPPT-LVI-TGDSMDSIESAIHHVLKPALLGKSLAGYEAILHDIQHLLTGNMSAKAAVEMALYDGWAQMCGLPLYQMLGGYR-D-TLETDYTVSVNSPEEMAADAENYLKQGFQTLKIKVGKDDIATDIARIQEIRKRVGSAVKLRLDANQGWRPKEAVTAIRKM-E-DAGL--GIELVEQPVHKDDLAGLKKVTDATDTPIMADESVFTPRQAFEVLQTRSADLINIKLMKAGGISGAEKINAMAEACGVECMVGSMIETKLGITAAAHFAASKRNITRFDFDAPLMLKTDVFNGGIT-YSG-STISMP-GKPGLGIIGAAL-------
129 HHSearch 59.9338% -95 - C1 -3Q45 AAEP_CYTH3 A:[1-360] MIITQVELYKSPVKLKEPFKISLGILTHANNVIVRIHTASGHIGYGECSPFMT-I-HGESMDTA-FIVGQYLAKGLIGTSCLDIVSNSLLMDAIIYGNSCIKSAFNIALYDLAAQHAGLPLYAFLGGKKDK-IIQTDYTVSIDEPHKMAADAVQIKKNGFEIIKVKVGGS-KELDVERIRMIREAAGDSITLRIDANQGWSVETAIETLTLL-E-P--Y--NIQHCEEPVSRNLYTALPKIRQACRIPIMADESCCNSFDAERLIQIQACDSFNLKLSKSAGITNALNIIRLAEQAHMPVQVGGFLESRLGFTAAAHVALVSKTICYYDFDTPLMFEADPVRGGIVYQQR-GIIEVP-ETAGLGAGYQKDYLS----
9 PsiBlast_PDB 59.3739% -92 - C1 -3Q4D AAEP_CYTH3 A:[1-351] MIITQVELYKSPVKLKEPFKISLGILTHANNVIVRIHTASGHIGYGECSPFMT-I-HGESMDT-AFIVGQYLAKGLIGTSCLDIVSNSLLMDAIIYGNSCIKSAFNIALYDLAAQHAGLPLYAFLGGKK-DKIIQTDYTVSIDEPHKMAADAVQIKKNGFEIIKVKVGGSK-ELDVERIRMIREAAGDSITLRIDANQGWSVETAIETLTLLEP----Y--NIQHCEEPVSRNLYTALPKIRQACRIPIMADESCCNSFDAERLIQIQACDSFNLKLSKSAGITNALNIIRLAEQAHMPVQVGGFLESRLGFTAAAHVALVSKTICYYDFDTPLMFEADPVRGGIV-YQQRGIIEVP-ETAGLG-------------
72 PsiBlast_CBE 58.6839% -92 - C1 -3Q4D AAEP_CYTH3 C:[1-351] MIITQVELYKSPVKLKEPFKISLGILTHANNVIVRIHTASGHIGYGECSPFMT-I-HGESMDT-AFIVGQYLAKGLIGTSCLDIVSNSLLMDAIIYGNSCIKSAFNIALYDLAAQHAGLPLYAFLGGKK-DKIIQTDYTVSIDEPHKMAADAVQIKKNGFEIIKVKVGGSK-ELDVERIRMIREAAGDSITLRIDANQGWSVETAIETLTLLEP----Y--NIQHCEEPVSRNLYTALPKIRQACRIPIMADESCCNSFDAERLIQIQACDSFNLKLSKSAGITNALNIIRLAEQAHMPVQVGGFLESRLGFTAAAHVALVSKTICYYDFDTPLMFEADPVRGGIV-YQQRGIIEVP-ETAGLG-------------
69 PsiBlast_CBE 58.6039% -91 - C1 -3Q4D AAEP_CYTH3 F:[1-351] MIITQVELYKSPVKLKEPFKISLGILTHANNVIVRIHTASGHIGYGECSPFMT-I-HGESMDT-AFIVGQYLAKGLIGTSCLDIVSNSLLMDAIIYGNSCIKSAFNIALYDLAAQHAGLPLYAFLGGKK-DKIIQTDYTVSIDEPHKMAADAVQIKKNGFEIIKVKVGGSK-ELDVERIRMIREAAGDSITLRIDANQGWSVETAIETLTLLEP----Y--NIQHCEEPVSRNLYTALPKIRQACRIPIMADESCCNSFDAERLIQIQACDSFNLKLSKSAGITNALNIIRLAEQAHMPVQVGGFLESRLGFTAAAHVALVSKTICYYDFDTPLMFEADPVRGGIV-YQQRGIIEVP-ETAGLG-------------
66 PsiBlast_CBE 58.5939% -92 - C1 -3Q4D AAEP_CYTH3 I:[1-351] MIITQVELYKSPVKLKEPFKISLGILTHANNVIVRIHTASGHIGYGECSPFMT-I-HGESMDT-AFIVGQYLAKGLIGTSCLDIVSNSLLMDAIIYGNSCIKSAFNIALYDLAAQHAGLPLYAFLGGKK-DKIIQTDYTVSIDEPHKMAADAVQIKKNGFEIIKVKVGGSK-ELDVERIRMIREAAGDSITLRIDANQGWSVETAIETLTLLEP----Y--NIQHCEEPVSRNLYTALPKIRQACRIPIMADESCCNSFDAERLIQIQACDSFNLKLSKSAGITNALNIIRLAEQAHMPVQVGGFLESRLGFTAAAHVALVSKTICYYDFDTPLMFEADPVRGGIV-YQQRGIIEVP-ETAGLG-------------
81 PsiBlast_CBE 58.4639% -94 - C1 -3Q45 AAEP_CYTH3 B:[1-351] MIITQVELYKSPVKLKEPFKISLGILTHANNVIVRIHTASGHIGYGECSPFMT-I-HGESMDT-AFIVGQYLAKGLIGTSCLDIVSNSLLMDAIIYGNSCIKSAFNIALYDLAAQHAGLPLYAFLGGKK-DKIIQTDYTVSIDEPHKMAADAVQIKKNGFEIIKVKVGGSK-ELDVERIRMIREAAGDSITLRIDANQGWSVETAIETLTLLEP----Y--NIQHCEEPVSRNLYTALPKIRQACRIPIMADESCCNSFDAERLIQIQACDSFNLKLSKSAGITNALNIIRLAEQAHMPVQVGGFLESRLGFTAAAHVALVSKTICYYDFDTPLMFEADPVRGGIV-YQQRGIIEVP-ETAGLG-------------
73 PsiBlast_CBE 58.3539% -91 - C1 -3Q4D AAEP_CYTH3 B:[1-351] MIITQVELYKSPVKLKEPFKISLGILTHANNVIVRIHTASGHIGYGECSPFMT-I-HGESMDT-AFIVGQYLAKGLIGTSCLDIVSNSLLMDAIIYGNSCIKSAFNIALYDLAAQHAGLPLYAFLGGKK-DKIIQTDYTVSIDEPHKMAADAVQIKKNGFEIIKVKVGGSK-ELDVERIRMIREAAGDSITLRIDANQGWSVETAIETLTLLEP----Y--NIQHCEEPVSRNLYTALPKIRQACRIPIMADESCCNSFDAERLIQIQACDSFNLKLSKSAGITNALNIIRLAEQAHMPVQVGGFLESRLGFTAAAHVALVSKTICYYDFDTPLMFEADPVRGGIV-YQQRGIIEVP-ETAGLG-------------
17 PsiBlast_PDB 50.5732% -96 - C1 -3R1Z XEEP_FRAP2 A:[4-344] -KIIDIKTSIIKIPLKRTFITAVRSTNHIDSLAVELTLDNGVKGYGVAPATTA-I-TGDTLQGMQYIIREIFAPVILGSDLSDYKQTLELAFKKVMFNSAAKMAIDLAYHDLLAKEQDISVAKLLGAKA-N-SIVTDVSISCGNVAETIQNIQNGVEANFTAIKVKTGAD-FNRDIQLLKALDNEFSKNIKFRFDANQGWNLAQTKQFIEEINKYS--L--NVEIIEQPVKYYDIKAMAEITKFSNIPVVADESVFDAKDAERVIDEQACNMINIKLAKTGGILEAQKIKKLADSAGISCMVGCMMESPAGILATASFALAE-DITVADLDPLDWVAKDLYSDYIT-FNE-PNI-----------------------
14 PsiBlast_PDB 50.4232% -93 - C1 -3R0U XEEP_FRAP2 A:[4-344] -KIIDIKTSIIKIPLKRTFITAVRSTNHIDSLAVELTLDNGVKGYGVAPATTA-I-TGDTLQGMQYIIREIFAPVILGSDLSDYKQTLELAFKKVMFNSAAKMAIDLAYHDLLAKEQDISVAKLLGAKA-N-SIVTDVSISCGNVAETIQNIQNGVEANFTAIKVKTGAD-FNRDIQLLKALDNEFSKNIKFRFDANQGWNLAQTKQFIEEINKYS--L--NVEIIEQPVKYYDIKAMAEITKFSNIPVVADESVFDAKDAERVIDEQACNMINIKLAKTGGILEAQKIKKLADSAGISCMVGCMMESPAGILATASFALAE-DITVADLDPLDWVAKDLYSDYIT-FNE-PNI-----------------------
118 HHSearch 49.9333% -90 - C1 -3R0U XEEP_FRAP2 A:[3-360] SKIIDIKTSIIKIPLKRTFITAVRSTNHIDSLAVELTLDNGVKGYGVAPAT-T-AITGDTLQGMQYIIREIFAPVILGSDLSDYKQTLELAFKKVMFNSAAKMAIDLAYHDLLAKEQDISVAKLLGAKA-N-SIVTDVSISCGNVAETIQNIQNGVEANFTAIKVKTGAD-FNRDIQLLKALDNEFSKNIKFRFDANQGWNLAQTKQFIEEI-N-K--YSLNVEIIEQPVKYYDIKAMAEITKFSNIPVVADESVFDAKDAERVIDEQACNMINIKLAKTGGILEAQKIKKLADSAGISCMVGCMMESPAGILATASFALAE-DITVADLDPLDWVAKDLYSDYIT-FNE-PNIILKDNLKGFGFNLAEN-------