@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu16030: (2016-06-25 )
MKIDFLTLFPEMFEGVLGSSILQKAQEKDAVQFQVVNFREYSDNKHNTVDDYPYGGGAGMVLKPQPVFDAVEDLTSKAAAAPRIILVCPQGERFTQKKAEQLAKEEHLLFICGHYEGYDERIREHLVTDEISIGDFVLTGGELPAMMIADSVVRLLPGVLGKEASHIEDSFSTGLLEHPHYTRPADYKGLKVPETLLSGNHAKIEEWRNKESIRRTYLRRPDLLKDHPLTEQQRKWISEWEKE

Atome Classification :

(57 SA) --.........10........20........30........40........50........60........70.....----..----.80........90........100.......110.......120....----...----130.......140.......150.......160.......170.-.--.....180.......190.......200.......210.......220..----.-...----.230.......240.-------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) --MKIDFLTLFPEMFEGVLGSSILQKAQEKDAVQFQVVNFREYSDNKHNTVDDYPYGGGAGMVLKPQPVFDAVEDLTS----KA----AAAPRIILVCPQGERFTQKKAEQLAKEEHLLFICGHYEGYDERIREHL----VTD----EISIGDFVLTGGELPAMMIADSVVRLLPGVLGKEASHIEDSFST-G--LLEHPHYTRPADYKGLKVPETLLSGNHAKIEEWRNKESIRRTYLRRPDLL----K-DHP----LTEQQRKWISEWEKE-------
22 PsiBlast_CBE 78.1746%-144 - C9 -4MCB TRMD_HAEIN B:[1-243] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVLGKQASAEEDSFAD-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
23 PsiBlast_CBE 76.7546%-142 - C9 -4YVK TRMD_HAEIN B:[21-263] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVLGKQASAEEDSFAD-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
44 PsiBlast_CBE 76.4946%-146 - C9 -4YQ4 ? A:[9-251] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVLG-------DSFAD-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
25 PsiBlast_CBE 76.3946%-142 - C9 -4YVI TRMD_HAEIN B:[21-263] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVLGKQASAEEDSFAD-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
24 PsiBlast_CBE 76.3646%-141 - C9 -4YVJ TRMD_HAEIN B:[21-263] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVLGKQASAEEDSFAD-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
9 PsiBlast_PDB 76.2346%-150 - C9 -4YVG TRMD_HAEIN A:[21-263] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVL--------DSFAD-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
45 PsiBlast_CBE 76.2246%-149 - C9 -4YQ3 ? A:[9-251] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVLG-----------D-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
35 PsiBlast_CBE 76.0446%-154 - C9 -4YQI ? A:[9-251] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVLG-----------D-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
33 PsiBlast_CBE 76.0446%-155 - C9 -4YQK ? A:[9-251] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVLG-----------D-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
4 PsiBlast_PDB 76.0346%-139 - C9 -1UAM TRMD_HAEIN A:[21-263] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVLGKQA--EEDSFAD-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
11 PsiBlast_PDB 75.9746%-149 - C9 -4YVI TRMD_HAEIN A:[21-263] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVL--------DSFAD-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
29 PsiBlast_CBE 75.7746%-153 - C9 -4YQP ? A:[9-251] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVLG-----------D-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
34 PsiBlast_CBE 75.7646%-157 - C9 -4YQJ ? A:[9-251] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVLG-----------D-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
15 PsiBlast_PDB 75.6646%-157 - C9 -4YPW ? A:[9-251] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVLG-----------D-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
27 PsiBlast_CBE 75.6446%-153 - C9 -4YQS ? A:[9-251] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVLG-----------D-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
19 PsiBlast_PDB 75.6146%-157 - C9 -4YQ0 ? A:[9-251] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVLG-----------D-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
40 PsiBlast_CBE 75.5746%-148 - C9 -4YQ9 ? A:[9-251] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVLG--------SFAD-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
38 PsiBlast_CBE 75.5646%-148 - C9 -4YQB ? A:[9-251] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVLG--------SFAD-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
42 PsiBlast_CBE 75.5446%-151 - C9 -4YQ6 ? A:[9-251] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVLG-----------D-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
30 PsiBlast_CBE 75.5146%-152 - C9 -4YQO ? A:[9-251] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVL------------D-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
1 PsiBlast_PDB 75.5146%-154 - C9 -1UAJ - TRMD_HAEIN A:[1-243] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVLG----------------LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
47 PsiBlast_CBE 75.4346%-152 - C9 -1P9P TRMD_ECOLI A:[7-249] --MWIGIISLFPEMFRAITDYGVTGRAVKNGLLSIQSWSPRDFTHDRHRTVDDRPYGGGPGMLMMVQPLRDAIHAAKA----AA----GEGAKVIYLSPQGRKLDQAGVSELATNQKLILVCGRYEGIDERVIQTE----IDE----EWSIGDYVLSGGELPAMTLIDSVSRFIPGVLG-----------E-G--LLDCPHYTRPEVLEGMEVPPVLLSGNHAEIRRWRLKQSLGRTWLRRPELL----E-NLA----LTEEQARLLAEFKTE-------
31 PsiBlast_CBE 75.4346%-155 - C9 -4YQN ? A:[9-251] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVLG-----------D-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
10 PsiBlast_PDB 75.4346%-149 - C9 -4YVH TRMD_HAEIN A:[21-263] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVL--------DSFAD-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
41 PsiBlast_CBE 75.2846%-150 - C9 -4YQ7 ? A:[9-251] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVLG-----------D-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
39 PsiBlast_CBE 75.2346%-151 - C9 -4YQA ? A:[9-251] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVLG-----------D-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
32 PsiBlast_CBE 75.2046%-151 - C9 -4YQL ? A:[9-251] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVLG--------SFAD-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
55 Fugue 75.1944%-154 - C9 -1UAL TRMD_HAEIN A:[19-270] SHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVLS---------FAD-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAEHNSLEHH
21 PsiBlast_CBE 75.1346%-158 - C9 -4MCC TRMD_HAEIN B:[1-243] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVL------------D-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
37 PsiBlast_CBE 75.1246%-155 - C9 -4YQC ? A:[9-251] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVLG-----------D-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
36 PsiBlast_CBE 75.1146%-154 - C9 -4YQG ? A:[9-251] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVLG-----------D-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
26 PsiBlast_CBE 74.9946%-154 - C9 -4YQT ? A:[9-251] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVLG-----------D-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
18 PsiBlast_PDB 74.9946%-152 - C9 -4YPZ ? A:[9-251] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVL------------D-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
65 HHSearch 74.9346%-145 - C9 -4YQD TRMD_HAEIN A:[21-263] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVLG--ASA---SFAD-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
14 PsiBlast_PDB 74.9346%-145 - C9 -4YQD TRMD_HAEIN A:[21-263] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVLG--ASA---SFAD-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
3 PsiBlast_PDB 74.6346%-154 - C9 -1UAL TRMD_HAEIN A:[21-263] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVL---------SFAD-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
46 PsiBlast_CBE 74.6146%-149 - C9 -4YQ2 ? A:[9-251] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVL------------D-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
2 PsiBlast_PDB 74.1746%-153 - C9 -1UAK TRMD_HAEIN A:[21-263] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVL---------SFAD-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
16 PsiBlast_PDB 73.9946%-152 - C9 -4YPX ? A:[9-251] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVLG----------AD-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
8 PsiBlast_PDB 73.9746%-156 - C9 -3AXZ TRMD_HAEIN A:[21-263] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVL-----------AD-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
17 PsiBlast_PDB 73.8346%-148 - C9 -4YPY ? A:[9-251] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVL---------SFAD-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
20 PsiBlast_PDB 73.6346%-146 - C9 -4YQ1 ? A:[9-251] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVLG---------FAD-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
7 PsiBlast_PDB 73.5946%-153 - C9 -4MCD TRMD_HAEIN A:[1-243] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVL---------SFAD-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
13 PsiBlast_PDB 73.5346%-146 - C9 -4YVK TRMD_HAEIN A:[21-263] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGV---------DSFAD-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
12 PsiBlast_PDB 73.4646%-147 - C9 -4YVJ TRMD_HAEIN A:[21-263] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGV---------DSFAD-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
51 PsiBlast_CBE 72.6340%-159 - C9 -4H3Y TRMD_BURP8 A:[22-272] --MQFDIVTLFPDMFRALTDWGITSRAAKQERYGLRTWNPRDFTTDNYRTIDDRPYGGGPGMVMLARPLEDAINAAKAAQAEQG----IGGARVVMMSPQGATLNHDKVMRFAAEPGLILLCGRYEAIDQRLIDRV----VDE----EVSLGDFVLSGGELPAMALIDAVVRHLPGVLNDAQSAVQDSFVD-G--LLDCPHYTRPEEYDGVRVPDVLLGGHHAEIEQWRRREALRNTWLKRPDLIVQARK-NKL----LSRADEAWLASLAKD-------
67 HHSearch 72.4542%-153 * C9 *4H3Z TRMD_BURP8 A:[22-271] --MQFDIVTLFPDMFRALTDWGITSRAAKQERYGLRTWNPRDFTTDNYRTIDDRPYGGGPGMVMLARPLEDAINAAKA----AQAEQGIGGARVVMMSPQGATLNHDKVMRFAAEPGLILLCGRYEAIDQRLIDRV----VDE----EVSLGDFVLSGGELPAMALIDAVVRHLPGVLN------QDSFVD-G--LLDCPHYTRPEEYDGVRVPDVLLGGHHAEIEQWRRREALRNTWLKRPDLI----V-QARKNKLLSRADEAWLASLAK--------
49 PsiBlast_CBE 72.1340%-156 - C9 -4H3Z TRMD_BURP8 A:[22-272] --MQFDIVTLFPDMFRALTDWGITSRAAKQERYGLRTWNPRDFTTDNYRTIDDRPYGGGPGMVMLARPLEDAINAAKAAQAEQG----IGGARVVMMSPQGATLNHDKVMRFAAEPGLILLCGRYEAIDQRLIDRV----VDE----EVSLGDFVLSGGELPAMALIDAVVRHLPGVLN------QDSFVD-G--LLDCPHYTRPEEYDGVRVPDVLLGGHHAEIEQWRRREALRNTWLKRPDLIVQARK-NKL----LSRADEAWLASLAKD-------
43 PsiBlast_CBE 71.4446%-150 - C9 -4YQ5 ? A:[9-251] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVLG--------SFAD-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
53 PsiBlast_CBE 71.4345%-159 - C9 -3QUV ? B:[5-235] --MKIDVVTIFPEYLQPVR-QSLPGKAIDAGLVDVAVHDLRRWTHDVHKSVDDSPYGGGPGMVMKPTVWGDALDEICT----SE----TL---LVVPTPAGYPFTQETAWQWSTEDHLVIACGRYEGIDQRVADDA----ATRMRVREVSIGDYVLNGGEAAALVIIEAVLRLVPGVLGNALSA---------ASLLEGPSYTRPPSWRGMDVPPVLLSGDHAKIAAWRAEQSRQRTIERRPDLL----GFDS---------------------------
48 PsiBlast_CBE 71.1840%-152 - C9 -4H3Z TRMD_BURP8 B:[22-272] --MQFDIVTLFPDMFRALTDWGITSRAAKQERYGLRTWNPRDFTTDNYRTIDDRPYGGGPGMVMLARPLEDAINAAKAAQAEQG----IGGARVVMMSPQGATLNHDKVMRFAAEPGLILLCGRYEAIDQRLIDRV----VDE----EVSLGDFVLSGGELPAMALIDAVVRHLPGVLNDAQSAVQDSFVD-G--LLDCPHYTRPEEYDGVRVPDVLLGGHHAEIEQWRRREALRNTWLKRPDLIVQARK-NKL----LSRADEAWLASLAKD-------
28 PsiBlast_CBE 71.1146%-153 - C9 -4YQQ ? A:[9-251] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVLG-----------D-G--LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELL----E-GLA----LTDEQRKLLKEAQAE-------
54 PsiBlast_CBE 70.3645%-170 - C9 -3QUV ? A:[5-231] --MKIDVVTIFPEYLQPVR-QSLPGKAIDAGLVDVAVHDLRRWTHDVHKSVDDSPYGGGPGMVMKPTVWGDALDEICT----SE----TL---LVVPTPAGYPFTQETAWQWSTEDHLVIACGRYEGIDQRVADDA----ATRMRVREVSIGDYVLNGGEAAALVIIEAVLRLVPGVLGN-------------ASLLEGPSYTRPPSWRGMDVPPVLLSGDHAKIAAWRAEQSRQRTIERRPDLL-----------------------------------
52 PsiBlast_CBE 69.0645%-162 - C9 -4IG6 TRMD_ANAPZ A:[22-243] --MIFNVLTIFPQMFPGPLGVSNLGSALKKGLWTLNVFDIRAFANNKHNTVDDTPYGGGPGMLLRADVLGRCIDEVLS----LH----PNT-KLMFTSPRGVSFTQDIARQTMNFDNITLLCGRFEGIDERVVDFY----KLQ----EVSIGDYVLSGGELAAMVIIDTCVRMVPGVIGNAESLKQESME--G--SLEYPQYTRPASWKGMEVPEVLLTGNHGEIEKWRRNASLSITAARRPDLL-----------------------------------
6 PsiBlast_PDB 68.6146%-162 - C9 -4MCC TRMD_HAEIN A:[1-219] --MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKA----AA----GEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTE----IDE----EWSIGDYVLTGGELPAMTLIDAVARFIPGVLG----------------LLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLR----------------------------------------