@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu23080: (2016-07-06 )
MNVLTIKGVSIGEGMPKIIIPLMGKTEKQILNEAEAVKLLNPDIVEWRVDVFEKANDREAVTKLISKLRKSLEDKLFLFTFRTHKEGGSMEMDESSYLALLESAIQTKDIDLIDIELFSGDANVKALVSLAEENNVYVVMSNHDFEKTPVKDEIISRLRKMQDLGAHIPKMAVMPNDTGDLLTLLDATYTMKTIYADRPIITMSMAATGLISRLSGEVFGSACTFGAGEEASAPGQIPVSELRSVLDILHKNTRG

Atome Classification :

(51 SA) .........10........20........30.....-...40........50........60........70-........80........90........100.......110.......120..---.....130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250...
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MNVLTIKGVSIGEGMPKIIIPLMGKTEKQILNEAEA-VKLLNPDIVEWRVDVFEKANDREAVTKLISKLRKS-LEDKLFLFTFRTHKEGGSMEMDESSYLALLESAIQTKDIDLIDIELFSGDANV---KALVSLAEENNVYVVMSNHDFEKTPVKDEIISRLRKMQDLGAHIPKMAVMPNDTGDLLTLLDATYTMKTIYADRPIITMSMAATGLISRLSGEVFGSACTFGAGEEASAPGQIPVSELRSVLDILHKNTRG
33 PsiBlast_CBE 89.1854%-107 - C4 -3M7W AROD_SALTY B:[5-254] -KTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALA-YREADFDILEWRVDHFANVTTAESVLEAAGAIREI-ITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV---KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ----
45 PsiBlast_CBE 89.1455%-116 - C4 -4CNP AROD_SALTI B:[1-250] MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALA-YREATFDILEWRVDHFMDIASTQSVLTAARVIRDA-MPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADV---KATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILH-----
46 PsiBlast_CBE 89.0755%-113 - C4 -4CNP AROD_SALTI A:[1-250] MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALA-YREATFDILEWRVDHFMDIASTQSVLTAARVIRDA-MPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADV---KATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILH-----
23 PsiBlast_CBE 88.6954%-109 - C4 -4GUJ AROD_SALTY B:[5-254] -KTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALA-YREADFDILEWRVDHFANVTTAESVLEAAGAIREI-ITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV---KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ----
26 PsiBlast_CBE 88.6754%-110 - C4 -3OEX AROD_SALTY D:[5-254] -KTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALA-YREADFDILEWRVDHFANVTTAESVLEAAGAIREI-ITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV---KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ----
51 PsiBlast_CBE 88.6655%-114 - C4 -4CLM AROD_SALTI B:[2-250] -KTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALA-YREATFDILEWRVDHFMDIASTQSVLTAARVIRDA-MPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADV---KATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILH-----
28 PsiBlast_CBE 88.5254%-106 - C4 -3OEX AROD_SALTY B:[4-254] MKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALA-YREADFDILEWRVDHFANVTTAESVLEAAGAIREI-ITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV---KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ----
44 PsiBlast_CBE 88.4055%-111 - C4 -4UIO AROD_SALTI A:[3-250] --TVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALA-YREATFDILEWRVDHFMDIASTQSVLTAARVIRDA-MPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADV---KATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILH-----
41 PsiBlast_CBE 88.3655%-109 - C4 -1L9W AROD_SALTI D:[1-250] MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALA-YREATFDILEWRVDHFMDIASTQSVLTAARVIRDA-MPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADV---KATVDYAHAHNVYVVMSNHDFHQTPSAEEMVSRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILH-----
6 PsiBlast_PDB 88.2254%-105 - C4 -4GFS AROD_SALTY A:[5-254] -KTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALA-YREADFDILEWRVDHFANVTTAESVLEAAGAIREI-ITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV---KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ----
32 PsiBlast_CBE 88.0754%-102 - C4 -3M7W AROD_SALTY C:[5-254] -KTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALA-YREADFDILEWRVDHFANVTTAESVLEAAGAIREI-ITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV---KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ----
21 PsiBlast_CBE 88.0254%-102 - C4 -3S42 AROD_SALTY B:[25-275] MKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALA-YREADFDILEWRVDHFANVTTAESVLEAAGAIREI-ITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV---KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ----
17 PsiBlast_PDB 88.0155%-113 - C4 -1GQN - AROD_SALTI A:[1-250] MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALA-YREATFDILEWRVDHFMDIASTQSVLTAARVIRDA-MPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADV---KATVDYAHAHNVYVVMSNHDFHQTPSAEEMVSRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILH-----
30 PsiBlast_CBE 87.9954%-101 - C4 -3M7W AROD_SALTY E:[5-254] -KTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALA-YREADFDILEWRVDHFANVTTAESVLEAAGAIREI-ITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV---KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ----
29 PsiBlast_CBE 87.8654%-103 - C4 -3M7W AROD_SALTY F:[5-254] -KTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALA-YREADFDILEWRVDHFANVTTAESVLEAAGAIREI-ITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV---KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ----
8 PsiBlast_PDB 87.7754%-105 - C4 -4GUJ AROD_SALTY A:[5-254] -KTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALA-YREADFDILEWRVDHFANVTTAESVLEAAGAIREI-ITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV---KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ----
24 PsiBlast_CBE 87.7154%-105 - C4 -4GUI AROD_SALTY B:[5-254] -KTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALA-YREADFDILEWRVDHFANVTTAESVLEAAGAIREI-ITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV---KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ----
42 PsiBlast_CBE 87.6755%-110 - C4 -1L9W AROD_SALTI C:[1-250] MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALA-YREATFDILEWRVDHFMDIASTQSVLTAARVIRDA-MPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADV---KATVDYAHAHNVYVVMSNHDFHQTPSAEEMVSRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILH-----
65 Fugue 87.6655%-112 - C4 -1QFE AROD_SALTI A:[1-252] MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALA-YREATFDILEWRVDHFMDIASTQSVLTAARVIRDA-MPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADV---KATVDYAHAHNVYVVMSNHDFHQTPSAEEMVSRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILHNA---
15 PsiBlast_PDB 87.6355%-113 - C4 -1QFE AROD_SALTI A:[1-250] MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALA-YREATFDILEWRVDHFMDIASTQSVLTAARVIRDA-MPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADV---KATVDYAHAHNVYVVMSNHDFHQTPSAEEMVSRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILH-----
47 PsiBlast_CBE 87.6055%-111 - C4 -4CNO AROD_SALTI D:[2-250] -KTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALA-YREATFDILEWRVDHFMDIASTQSVLTAARVIRDA-MPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADV---KATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVK----PGQIAVNDLRSVLMILH-----
39 PsiBlast_CBE 87.5953%-109 - C4 -3NNT AROD_SALTY B:[25-275] MKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALA-YREADFDILEWRVDHFANVTTAESVLEAAGAIREI-ITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV---KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPMIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ----
48 PsiBlast_CBE 87.5355%-112 - C4 -4CNO AROD_SALTI C:[1-250] MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALA-YREATFDILEWRVDHFMDIASTQSVLTAARVIRDA-MPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADV---KATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVK----PGQIAVNDLRSVLMILH-----
43 PsiBlast_CBE 87.5255%-108 - C4 -1L9W AROD_SALTI B:[1-250] MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALA-YREATFDILEWRVDHFMDIASTQSVLTAARVIRDA-MPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADV---KATVDYAHAHNVYVVMSNHDFHQTPSAEEMVSRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILH-----
16 PsiBlast_PDB 87.4755%-107 - C4 -1L9W AROD_SALTI A:[1-250] MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALA-YREATFDILEWRVDHFMDIASTQSVLTAARVIRDA-MPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADV---KATVDYAHAHNVYVVMSNHDFHQTPSAEEMVSRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILH-----
25 PsiBlast_CBE 87.4554%-112 - C4 -4GFS AROD_SALTY B:[4-254] MKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALA-YREADFDILEWRVDHFANVTTAESVLEAAGAIREI-ITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV---KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVK---APGQISVADLRTVLTILHQ----
50 PsiBlast_CBE 87.4355%-119 - C4 -4CNN AROD_SALTI B:[2-250] -KTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALA-YREATFDILEWRVDHFMDIASTQSVLTAARVIRDA-MPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADV---KATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVK----PGQIAVNDLRSVLMILH-----
13 PsiBlast_PDB 87.4253%-106 - C4 -3NNT AROD_SALTY A:[25-275] MKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALA-YREADFDILEWRVDHFANVTTAESVLEAAGAIREI-ITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV---KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPMIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ----
11 PsiBlast_PDB 87.3753%-107 - C4 -4GUH AROD_SALTY A:[25-275] MKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALA-YREADFDILEWRVDHFANVTTAESVLEAAGAIREI-ITDKPLLFTFRSAKAGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV---KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ----
2 PsiBlast_PDB 87.3454% -99 - C4 -3LB0 AROD_SALTY A:[25-275] MKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALA-YREADFDILEWRVDHFANVTTAESVLEAAGAIREI-ITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV---KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ----
7 PsiBlast_PDB 87.2954%-105 - C4 -4GUI AROD_SALTY A:[5-254] -KTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALA-YREADFDILEWRVDHFANVTTAESVLEAAGAIREI-ITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV---KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ----
38 PsiBlast_CBE 87.1553%-105 - C4 -4IUO AROD_SALTY B:[25-275] MKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALA-YREADFDILEWRVDHFANVTTAESVLEAAGAIREI-ITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV---KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPMIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ----
40 PsiBlast_CBE 87.1455%-111 - C4 -1QFE AROD_SALTI B:[1-250] MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALA-YREATFDILEWRVDHFMDIASTQSVLTAARVIRDA-MPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADV---KATVDYAHAHNVYVVMSNHDFHQTPSAEEMVSRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILH-----
18 PsiBlast_PDB 87.1355%-119 - C4 -4CNO AROD_SALTI A:[2-250] -KTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALA-YREATFDILEWRVDHFMDIASTQSVLTAARVIRDA-MPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADV---KATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVK----PGQIAVNDLRSVLMILH-----
14 PsiBlast_PDB 87.0353%-107 - C4 -4IUO AROD_SALTY A:[25-275] MKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALA-YREADFDILEWRVDHFANVTTAESVLEAAGAIREI-ITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV---KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPMIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ----
49 PsiBlast_CBE 86.8255%-116 - C4 -4CNO AROD_SALTI B:[2-250] -KTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALA-YREATFDILEWRVDHFMDIASTQSVLTAARVIRDA-MPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADV---KATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVK----PGQIAVNDLRSVLMILH-----
57 PsiBlast_CBE 86.5550%-119 - C4 -3JS3 AROD_PEPD6 C:[8-256] ---VQVKNITIGEGRPKICVPIIGKNKKDIIKEAKE-LKDACLDIIEWRVDFFENVENIKEVKEVLYELRSY-IHDIPLLFTFRSVVEGGEKLISRDYYTTLNKEISNTGLVDLIDVELFMGDEVI---DEVVNFAHKKEVKVIISNHDFNKTPKKEEIVSRLCRMQELGADLPKIAVMPQNEKDVLVLLEATNEMFKIYADRPIITMSMSGMGVISRLCGEIFGSALTFGAAKSVSAPGQISFKELNSVLNLLHKS---
10 PsiBlast_PDB 86.1453%-111 - C4 -4GUG AROD_SALTY A:[25-275] MKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALA-YREADFDILEWRVDHFANVTTAESVLEAAGAIREI-ITDKPLLFTFRSAKAGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV---KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVK----PGQISVADLRTVLTILHQ----
34 PsiBlast_CBE 86.1353%-103 - C4 -4GUH AROD_SALTY B:[25-275] MKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALA-YREADFDILEWRVDHFANVTTAESVLEAAGAIREI-ITDKPLLFTFRSAKAGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV---KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ----
56 PsiBlast_CBE 85.9250%-115 - C4 -3JS3 AROD_PEPD6 D:[8-256] ---VQVKNITIGEGRPKICVPIIGKNKKDIIKEAKE-LKDACLDIIEWRVDFFENVENIKEVKEVLYELRSY-IHDIPLLFTFRSVVEGGEKLISRDYYTTLNKEISNTGLVDLIDVELFMGDEVI---DEVVNFAHKKEVKVIISNHDFNKTPKKEEIVSRLCRMQELGADLPKIAVMPQNEKDVLVLLEATNEMFKIYADRPIITMSMSGMGVISRLCGEIFGSALTFGAAKSVSAPGQISFKELNSVLNLLHKS---
35 PsiBlast_CBE 85.7153%-116 - C4 -4GUG AROD_SALTY B:[27-275] --TVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALA-YREADFDILEWRVDHFANVTTAESVLEAAGAIREI-ITDKPLLFTFRSA----EQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEV---KATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ----
59 PsiBlast_CBE 85.7050%-114 - C4 -3JS3 AROD_PEPD6 A:[8-256] ---VQVKNITIGEGRPKICVPIIGKNKKDIIKEAKE-LKDACLDIIEWRVDFFENVENIKEVKEVLYELRSY-IHDIPLLFTFRSVVEGG