@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu23870: (2016-07-07 )
MPGKSRIIFHIDMNSFYASVEMAYDPALRGKPVAVAGNVKERKGIVVTCSYEARARGVKTTMPVWQAKRHCPELIVLPPNFDRYRNSSRAMFTILREYTDLVEPVSIDEGYMDMTDTPYSSRALETAKEIQSRLQKELLLPSSIGIAPNKFLAKMASDMKKPLGITILRKRQVPDILWPLPVGEMHGVGKKTAEKLKGLGIHTIGELAAADEHSLKRLLGINGPRLKNKANGIHHAPVDPERIYEFKSVGNSSTLSHDSSDEEELLGVFRKLAASVSDRLQRKEVMASKLFIMIRYADWRTITRSTTLRNPIDQKNDILKEAEHLFFKHWNKNPVRLLGITGTDLVEKEQAYKQLDLFSFNEDAKDEPIQQMMEKLNKKYGTKLIRKGATLKKEESKTKGTSFNKDFFQDEKKS

Atome Classification :

(75 SA) .........10........20........30.....--.--..40........50........60........70.......-------.80........90.-.......100.......110......-.-----120-.----------------------------------------------------.......130.......140.......150.......160.......170.......180.......190..-.....200.......210.......220.-...-....230.......240.......250......--.260.......270.......280-..----.--.....290.......300---.......--310.......320......---.330........340.......350.......360.......370.......380.......390.......400.......410..
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MPGKSRIIFHIDMNSFYASVEMAYDPALRGKPVAVA--G--NVKERKGIVVTCSYEARARGVKTTMPVWQAKRHCPELIVLP-------PNFDRYRNSSRAMF-TILREYTDLVEPVSIDEGYMDMTDTP-Y-----S-S-R----------------------------------------------------ALETAKEIQSRLQKELLLPSSIGIAPNKFLAKMASDMKKPLGITILRKRQVPDILWPLPVGEMHGVGKKTAE-KLKGLGIHTIGELAAADEHSLKRLLG-IN-GPR-LKNKANGIHHAPVDPERIYEFKSVGNSSTLSHD--SSDEEELLGVFRKLAASVSDRLQ--RK----E--VMASKLFIMIRYADWRTI---TRSTTLR--NPIDQKNDILKEAEHLFFK---HW-NKNPVRLLGITGTDLVEKEQAYKQLDLFSFNEDAKDEPIQQMMEKLNKKYGTKLIRKGATLKKEESKTKGTSFNKDFFQDEKKS
6 PsiBlast_PDB 71.0235% -16 - C3 -4IR1 DPO4_ECOLI F:[2-340] ----SRKIIHVDMDCFFAAVEMRDNPALRDIPIAIG--G--S-RERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLP-------GRFDAYKEASNHIR-EIFSRYTSRIEPLSLDEAYLDVTDSV-H-----CHG-S----------------------------------------------------ATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAA-KLEAMGLRTCGDVQKCDLVMLLKRFG-KF-GRI-LWERSQGIDERDVNSERLR--KSVGVERTMAED--IHHWSECEAIIERLYPELERRLAKVKP----D--LLIARQGVKLKFDDFQQT---TQEHVW----PRLNKADLIATARKTWDE---RR-GGRGVRLVGLHVTLL---------------------------------------------------------------------
3 PsiBlast_PDB 69.8235% -12 - C3 -4IRK DPO4_ECOLI B:[2-340] ----SRKIIHVDMDCFFAAVEMRDNPALRDIPIAIG--G--S-RERRGVISTANYPARKFGVRSAMPTGMALALCPHLTLLP-------GRFDAYKEASNHIR-EIFSRYTSRIEPLSLDEAYLDVTDSV-H-----CHG-S----------------------------------------------------ATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAA-KLEAMGLRTCGDVQACDLVMLLKRFG-KF-GRI-LWERSQGIDERDVNSERLR--KSVGVERTMAED--IHHWSECEAIIERLYPELERRLAKVKP----D--LLIARQGVKLKFDDFQQT---TQEHVW----PRLNKADLIATARKTWDE---RR-GGRGVRLVGLHVTLL---------------------------------------------------------------------
23 PsiBlast_CBE 69.6235% -13 - C3 -4IRK DPO4_ECOLI A:[2-340] ----SRKIIHVDMDCFFAAVEMRDNPALRDIPIAIG--G--S-RERRGVISTANYPARKFGVRSAMPTGMALALCPHLTLLP-------GRFDAYKEASNHIR-EIFSRYTSRIEPLSLDEAYLDVTDSV-H-----CHG-S----------------------------------------------------ATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAA-KLEAMGLRTCGDVQACDLVMLLKRFG-KF-GRI-LWERSQGIDERDVNSERLR--KSVGVERTMAED--IHHWSECEAIIERLYPELERRLAKVKP----D--LLIARQGVKLKFDDFQQT---TQEHVW----PRLNKADLIATARKTWDE---RR-GGRGVRLVGLHVTLL---------------------------------------------------------------------
26 PsiBlast_CBE 69.6035% -13 - C3 -4Q43 DPO4_ECOLI F:[2-340] ----SRKIIHVDMDCFFAAVEMRDNPALRDIPIAIG--G--S-RERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLP-------GRFDAYKEASNHIR-EIFSRYTSRIEPLSLDEAYLDVTDSV-H-----CHG-S----------------------------------------------------ATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAA-KLEAMGLRTCGDVQKCDLVMLLKRFG-KF-GRI-LWERSQGIDERDVNSERLR--KSVGVERTMAED--IHHWSECEAIIERLYPELERRLAKVKP----D--LLIARQGVKLKFDDFQQT---TQEHVW----PRLNKADLIATARKTWDE---RR-GGRGVRLVGLHVTLL---------------------------------------------------------------------
5 PsiBlast_PDB 69.3235% -14 - C3 -4Q45 DPO4_ECOLI F:[2-340] ----SRKIIHVDMDCFFAAVEMRDNPALRDIPIAIG--G--S-RERRGVISTANYPARKFGVRSAMPTGMALALCPHLTLLP-------GRFDAYKEASNHIR-EIFSRYTSRIEPLSLDEAYLDVTDSV-H-----CHG-S----------------------------------------------------ATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAA-KLEAMGLRTCGDVQACDLVMLLKRFG-KF-GRI-LWERSQGIDERDVNSERLR--KSVGVERTMAED--IHHWSECEAIIERLYPELERRLAKVKP----D--LLIARQGVKLKFDDFQQT---TQEHVW----PRLNKADLIATARKTWDE---RR-GGRGVRLVGLHVTLL---------------------------------------------------------------------
9 PsiBlast_PDB 69.2735% -12 - C3 -4R8U DPO4_ECOLI A:[1-339] ----SRKIIHVDMDCFFAAVEMRDNPALRDIPIAIG--G--S-RERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLP-------GRFDAYKEASNHIR-EIFSRYTSRIEPLSLDEAYLDVTDSV-H-----CHG-S----------------------------------------------------ATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAA-KLEAMGLRTCGDVQKCDLVMLLKRFG-KF-GRI-LWERSQGIDERDVNSERLR--KSVGVERTMAED--IHHWSECEAIIERLYPELERRLAKVKP----D--LLIARQGVKLKFDDFQQT---TQEHVW----PRLNKADLIATARKTWDE---RR-GGRGVRLVGLHVTLL---------------------------------------------------------------------
113 HHSearch 69.2136% -18 - C3 -4Q45 DPO4_ECOLI F:[2-342] ----SRKIIHVDMDCFFAAVEMRDNPALRDIPIAIG--G--SR-ERRGVISTANYPARKFGVRSAMPTGMALALCPHLTLLP-------GRFDAYKEASNHIR-EIFSRYTSRIEPLSLDEAYLDVTDSV-H-----C-HGS----------------------------------------------------ATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAA-KLEAMGLRTCGDVQACDLVMLLKRFG-KF-GRI-LWERSQGIDERDVNS--ERLRKSVGVERTMAED--IHHWSECEAIIERLYPELERRLA--KV----KPDLLIARQGVKLKFDDFQQT---TQ--EHV--WPRLNKADLIATARKTW-D---ERRGGRGVRLVGLHVTLLDP-------------------------------------------------------------------
4 PsiBlast_PDB 69.1635% -12 - C3 -4Q44 DPO4_ECOLI A:[2-340] ----SRKIIHVDMDCFFAAVEMRDNPALRDIPIAIG--G--S-RERRGVISTANYPARKFGVRSAMPTGMALALCPHLTLLP-------GRFDAYKEASNHIR-EIFSRYTSRIEPLSLDEAYLDVTDSV-H-----CHG-S----------------------------------------------------ATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAA-KLEAMGLRTCGDVQACDLVMLLKRFG-KF-GRI-LWERSQGIDERDVNSERLR--KSVGVERTMAED--IHHWSECEAIIERLYPELERRLAKVKP----D--LLIARQGVKLKFDDFQQT---TQEHVW----PRLNKADLIATARKTWDE---RR-GGRGVRLVGLHVTLL---------------------------------------------------------------------
2 PsiBlast_PDB 69.0635% -12 - C3 -4IRD DPO4_ECOLI F:[2-340] ----SRKIIHVDMDCFFAAVEMRDNPALRDIPIAIG--G--S-RERRGVISTANYPARKFGVRSAMPTGMALALCPHLTLLP-------GRFDAYKEASNHIR-EIFSRYTSRIEPLSLDEAYLDVTDSV-H-----CHG-S----------------------------------------------------ATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAA-KLEAMGLRTCGDVQACDLVMLLKRFG-KF-GRI-LWERSQGIDERDVNSERLR--KSVGVERTMAED--IHHWSECEAIIERLYPELERRLAKVKP----D--LLIARQGVKLKFDDFQQT---TQEHVW----PRLNKADLIATARKTWDE---RR-GGRGVRLVGLHVTLL---------------------------------------------------------------------
22 PsiBlast_CBE 68.9435% -17 - C3 -4Q44 DPO4_ECOLI F:[2-340] ----SRKIIHVDMDCFFAAVEMRDNPALRDIPIAIG--G--S-RERRGVISTANYPARKFGVRSAMPTGMALALCPHLTLLP-------GRFDAYKEASNHIR-EIFSRYTSRIEPLSLDEAYLDVTDSV-H-----CHG-S----------------------------------------------------ATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAA-KLEAMGLRTCGDVQACDLVMLLKRFG-KF-GRI-LWERSQGIDERDVNSERLR--KSVGVERTMAED--IHHWSECEAIIERLYPELERRLAKVKP----D--LLIARQGVKLKFDDFQQT---TQEHVW----PRLNKADLIATARKTWDE---RR-GGRGVRLVGLHVTLL---------------------------------------------------------------------
7 PsiBlast_PDB 68.8535% -13 - C3 -4IR9 DPO4_ECOLI F:[2-340] ----SRKIIHVDMDCFFAAVEMRDNPALRDIPIAIG--G--S-RERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLP-------GRFDAYKEASNHIR-EIFSRYTSRIEPLSLDEAYLDVTDSV-H-----CHG-S----------------------------------------------------ATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAA-KLEAMGLRTCGDVQKCDLVMLLKRFG-KF-GRI-LWERSQGIDERDVNSERLR--KSVGVERTMAED--IHHWSECEAIIERLYPELERRLAKVKP----D--LLIARQGVKLKFDDFQQT---TQEHVW----PRLNKADLIATARKTWDE---RR-GGRGVRLVGLHVTLL---------------------------------------------------------------------
1 PsiBlast_PDB 68.6535% -7 - C3 -4IRC DPO4_ECOLI F:[2-340] ----SRKIIHVDMDCFFAAVEMRDNPALRDIPIAIG--G--S-RERRGVISTANYPARKFGVRSAMPTGMALALCPHLTLLP-------GRFDAYKEASNHIR-EIFSRYTSRIEPLSLDEAYLDVTDSV-H-----CHG-S----------------------------------------------------ATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAA-KLEAMGLRTCGDVQACDLVMLLKRFG-KF-GRI-LWERSQGIDERDVNSERLR--KSVGVERTMAED--IHHWSECEAIIERLYPELERRLAKVKP----D--LLIARQGVKLKFDDFQQT---TQEHVW----PRLNKADLIATARKTWDE---RR-GGRGVRLVGLHVTLL---------------------------------------------------------------------
21 PsiBlast_CBE 68.6335% -12 - C3 -4Q45 DPO4_ECOLI A:[2-340] ----SRKIIHVDMDCFFAAVEMRDNPALRDIPIAIG--G--S-RERRGVISTANYPARKFGVRSAMPTGMALALCPHLTLLP-------GRFDAYKEASNHIR-EIFSRYTSRIEPLSLDEAYLDVTDSV-H-----CHG-S----------------------------------------------------ATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAA-KLEAMGLRTCGDVQACDLVMLLKRFG-KF-GRI-LWERSQGIDERDVNSERLR--KSVGVERTMAED--IHHWSECEAIIERLYPELERRLAKVKP----D--LLIARQGVKLKFDDFQQT---TQEHVW----PRLNKADLIATARKTWDE---RR-GGRGVRLVGLHVTLL---------------------------------------------------------------------
28 PsiBlast_CBE 68.3235% -13 - C3 -4IR1 DPO4_ECOLI A:[2-340] ----SRKIIHVDMDCFFAAVEMRDNPALRDIPIAIG--G--S-RERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLP-------GRFDAYKEASNHIR-EIFSRYTSRIEPLSLDEAYLDVTDSV-H-----CHG-S----------------------------------------------------ATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAA-KLEAMGLRTCGDVQKCDLVMLLKRFG-KF-GRI-LWERSQGIDERDVNSERLR--KSVGVERTMAED--IHHWSECEAIIERLYPELERRLAKVKP----D--LLIARQGVKLKFDDFQQT---TQEHVW----PRLNKADLIATARKTWDE---RR-GGRGVRLVGLHVTLL---------------------------------------------------------------------
29 PsiBlast_CBE 68.0234% -12 - C3 -4R8U ? B:[1-336] -----RKIIHVDMDCFFAAVEMRDNPALRDIPIAIG--G--S-RERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLP-------GRFDAYKEASNHIR-EIFSRYTSRIEPLSLDEAYLDVTDSV-H-----CHG-S----------------------------------------------------ATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAA-KLEAMGLRTCGDVQKCDLVMLLKRFG-KF-GRI-LWERSQGIDERDVNSERLR--KSVGVERTMAED--IHHWSECEAIIERLYPELERRLAKVKP----D--LLIARQGVKLKFDDFQQT---TQEHVW----PRLNKADLIATARKTWDE---RR-GGRGVRLVGLHVT-----------------------------------------------------------------------
27 PsiBlast_CBE 68.0235% -9 - C3 -4IR9 DPO4_ECOLI A:[2-340] ----SRKIIHVDMDCFFAAVEMRDNPALRDIPIAIG--G--S-RERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLP-------GRFDAYKEASNHIR-EIFSRYTSRIEPLSLDEAYLDVTDSV-H-----CHG-S----------------------------------------------------ATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAA-KLEAMGLRTCGDVQKCDLVMLLKRFG-KF-GRI-LWERSQGIDERDVNSERLR--KSVGVERTMAED--IHHWSECEAIIERLYPELERRLAKVKP----D--LLIARQGVKLKFDDFQQT---TQEHVW----PRLNKADLIATARKTWDE---RR-GGRGVRLVGLHVTLL---------------------------------------------------------------------