@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu27870: (2016-07-13 )
MSKKTIAVIGSGAAALSLAAAFPPSYEVTVITKKSVKNSNSVYAQGGIAAAYAKDDSIEAHLEDTLYAGCGHNNLAIVADVLHDGKMMVQSLLERGFPFDRNERGGVCLGREGAHSYNRIFHAGGDATGRLLIDYLLKRINSKIKLIENETAADLLIEDGRCIGVMTKDSKGRLKVRHADEVVLAAGGCGNLFLHHTNDLTVTGDGLSLAYRAGAELTDLEFTQFHPTLLVKNGVSYGLVSEAVRGEGGCLVDENGRRIMAERHPLGDLAPRDIVSRVIHEEMAKGNRVYIDFSAISDFETRFPTITAICEKAGIDIHSGKIPVAPGMHFLMGGVSVNRWGETTVPGLYAIGETACSGLHGANRLASNSLLEALVFGKRAAEHIIQKPVYNRQYQSGLETSVFYEVPDIEGHELQSKMTSHMSILREQSSLIELSIWLHTLPFQEVNVKDITIRQMELSHLWQTAKLMTFSALLREESRGAHFRTDFPHAEVSWQGRQIVHTKKGTKIRKNEGIWNNESFTAEKITESLFS

Atome Classification :

(23 SA) ----.........10........20.-..--.....30........40........50..-----.--.....60........70........80........90........100---.......---------------------.110.....--------..120...---------....130.....-..-140.--..-......150......--------.-------160-----.......----..-170........180.......190.......200.......210..-.....220.......230.......240.......250.......-----260....------------.-.-------.270.......280...--.--------.--.--------.290..-..--.--.--.-300......-.-310-.-......320.......330......----------.340---------.---------......350.......360.......370.......380....-----------.-------.---.390--....-------.---.--.------------.---.400---.--........---410-----.------.----.----.....420.......430----.-----....-----..440----------.....----.----.---450-------..----------.....460.......470.......480....--...490--.-.......500.......510.......520.......530
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) ----MSKKTIAVIGSGAAALSLAAAF-PP--SYEVTVITKKSVKNSNSVYAQGGIAAAYA-----K--DDSIEAHLEDTLYAGCGHNNLAIVADVLHDGKMMVQSLLERGFPFDR----NERGGVC---------------------LGREGAHSY--------NRIFHAGG---------DATGRLLIDYLL-KR-I--N--SK-IKLIENETAADLLIE--------D-------G-------RCIGVMT----KD-S-KGRLKVRHADEVVLAAGGCGNLFLHHTNDLTVTGDGLSLAYRAG-AELTDLEFTQFHPTLLVKNGVSYGLVSEAVRGEGGCLVDENGRRI-----MAERHPL------------G-D-------LAPRDIVSRVIHEEMAK--G--------N--R--------VYIDFS-AI--S--D--F-ETRFPTITA-I-CEK-A-GIDIHSGKIPVAPGMHFLMGGVSVN----------RWGE---------T---------TVPGLYAIGETACSGLHGANRLASNSLLEALVFGKRAAEHIIQ-----------K-------P---VY----NRQY-------Q---S--G------------L---ET-----S--VFYEVPDI---EG------H------E----L----QSKMTSHMSILREQSSLI----E-----LSIW-----LHTLP----------FQEVN----V----K---DIT-------IR----------QMELSHLWQTAKLMTFSALLREESRGAHFRTD--FPHAE---V-SWQGRQIVHTKKGTKIRKNEGIWNNESFTAEKITESLFS
113 HHSearch 87.6733% 0 - C- -2H88 SDHA_CHICK A:[17-559] -----HEFDAVVVGAGGAGLRAAFGLSEA--GFNTACVTKLFPTRSHTVAAQGGINAALG-----NMEDDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVIELENYGMPFSR----TEEGKIY---------------------QRAFGGQSLQFGKGGQAHRCCCV-A---------DRTGHSLLHTLY-GR-SL-R--YD-TSYFVEYFALDLLME--------N-------G-------ECRGVIA----LC-IEDGTIHRFRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAG-LPCQDLEFVQFHPTGIYGA---GCLITEGCRGEGGILINSQGERF-----MERYAPVA-----------K-D-------LASRDVVSRSMTIEIRE--GRGCGPEK-D--H--------VYLQLH-HL--PPQQ--L-ATRLPGISETA-MIF-A-GVDVTKEPIPVLPTVHYNMGGIPTN----------YKGQVITHVNGEDK---------VVPGLYACGEAASASVHGANRLGANSLLDLVVFGRACALTIAE-----------T-------C---KP----GEPVP------S---I--KPNAGEESVAN--LDKLRF-----A--DGTIRTSE---AR------L------N----M----QKTMQSHAAVFRTGSILQEGCEK-----LSQI-----YRDLA----------HLKTF----DRGIVW---NTD-------LVE---------TLELQNLMLCALQTIYGAEARKESRGAHARED--YKLRI---D----------------------------------------
45 PsiBlast_CBE 85.0432% 0 - C- -2FBW SDHA_CHICK A:[42-554] --------------------------------FNTACVTKLFPTRSHTVAAQGGINAALGNM---E--DDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVIELENYGMPFSR----TEEGKIY---------------------QRAFGGQSL--------Q--FGKGGQAHRCCCVADRTGHSLLHTLY-GRSL--R--YD-TSYFVEYFALDLLME--------N-------G-------ECRGVIA----LCIE-DGTIHRFRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAG-LPCQDLEFVQFHPTGIYGAGC---LITEGCRGEGGILINSQGERF-----MERYAPV------------AKD-------LASRDVVSRSMTIEIRE--GRGCGPEK-D--H--------VYLQLH-HLPPQ--Q--L-ATRLPGISE-T-AMIFA-GVDVTKEPIPVLPTVHYNMGGIPTN----------YKGQ---------VITHVNGEDKVVPGLYACGEAASASVHGANRLGANSLLDLVVFGRACALTIAETCKPG------E-------P---VP----SIKP-------N---A--G------------E---ESVANLDK--LRFADGTI---RT------S------EARLNM----QKTMQSHAAVFRTGSILQ----EGCEK-LSQI-----YRDLA----------HLKTF----D----R---GIVWNTDL--VE----------TLELQNLMLCALQTIYGAEARKESRGAHARED--Y------------------------------------------------
44 PsiBlast_CBE 85.0432% 0 - C- -2FBW SDHA_CHICK N:[42-554] --------------------------------FNTACVTKLFPTRSHTVAAQGGINAALGNM---E--DDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVIELENYGMPFSR----TEEGKIY---------------------QRAFGGQSL--------Q--FGKGGQAHRCCCVADRTGHSLLHTLY-GRSL--R--YD-TSYFVEYFALDLLME--------N-------G-------ECRGVIA----LCIE-DGTIHRFRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAG-LPCQDLEFVQFHPTGIYGAGC---LITEGCRGEGGILINSQGERF-----MERYAPV------------AKD-------LASRDVVSRSMTIEIRE--GRGCGPEK-D--H--------VYLQLH-HLPPQ--Q--L-ATRLPGISE-T-AMIFA-GVDVTKEPIPVLPTVHYNMGGIPTN----------YKGQ---------VITHVNGEDKVVPGLYACGEAASASVHGANRLGANSLLDLVVFGRACALTIAETCKPG------E-------P---VP----SIKP-------N---A--G------------E---ESVANLDK--LRFADGTI---RT------S------EARLNM----QKTMQSHAAVFRTGSILQ----EGCEK-LSQI-----YRDLA----------HLKTF----D----R---GIVWNTDL--VE----------TLELQNLMLCALQTIYGAEARKESRGAHARED--Y------------------------------------------------
43 PsiBlast_CBE 85.0432% 0 - C- -2H88 SDHA_CHICK A:[42-554] --------------------------------FNTACVTKLFPTRSHTVAAQGGINAALGNM---E--DDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVIELENYGMPFSR----TEEGKIY---------------------QRAFGGQSL--------Q--FGKGGQAHRCCCVADRTGHSLLHTLY-GRSL--R--YD-TSYFVEYFALDLLME--------N-------G-------ECRGVIA----LCIE-DGTIHRFRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAG-LPCQDLEFVQFHPTGIYGAGC---LITEGCRGEGGILINSQGERF-----MERYAPV------------AKD-------LASRDVVSRSMTIEIRE--GRGCGPEK-D--H--------VYLQLH-HLPPQ--Q--L-ATRLPGISE-T-AMIFA-GVDVTKEPIPVLPTVHYNMGGIPTN----------YKGQ---------VITHVNGEDKVVPGLYACGEAASASVHGANRLGANSLLDLVVFGRACALTIAETCKPG------E-------P---VP----SIKP-------N---A--G------------E---ESVANLDK--LRFADGTI---RT------S------EARLNM----QKTMQSHAAVFRTGSILQ----EGCEK-LSQI-----YRDLA----------HLKTF----D----R---GIVWNTDL--VE----------TLELQNLMLCALQTIYGAEARKESRGAHARED--Y------------------------------------------------
42 PsiBlast_CBE 85.0432% 0 - C- -2H88 SDHA_CHICK N:[42-554] --------------------------------FNTACVTKLFPTRSHTVAAQGGINAALGNM---E--DDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVIELENYGMPFSR----TEEGKIY---------------------QRAFGGQSL--------Q--FGKGGQAHRCCCVADRTGHSLLHTLY-GRSL--R--YD-TSYFVEYFALDLLME--------N-------G-------ECRGVIA----LCIE-DGTIHRFRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAG-LPCQDLEFVQFHPTGIYGAGC---LITEGCRGEGGILINSQGERF-----MERYAPV------------AKD-------LASRDVVSRSMTIEIRE--GRGCGPEK-D--H--------VYLQLH-HLPPQ--Q--L-ATRLPGISE-T-AMIFA-GVDVTKEPIPVLPTVHYNMGGIPTN----------YKGQ---------VITHVNGEDKVVPGLYACGEAASASVHGANRLGANSLLDLVVFGRACALTIAETCKPG------E-------P---VP----SIKP-------N---A--G------------E---ESVANLDK--LRFADGTI---RT------S------EARLNM----QKTMQSHAAVFRTGSILQ----EGCEK-LSQI-----YRDLA----------HLKTF----D----R---GIVWNTDL--VE----------TLELQNLMLCALQTIYGAEARKESRGAHARED--Y------------------------------------------------
30 PsiBlast_CBE 84.3131% 0 - C- -1KF6 FRDA_ECOLI M:[32-537] ---------------------------------KIALISKVYPMRSHTVAAEGGSAAVAQ-----D--HDSFEYHFHDTVAGGDWLCEQDVVDYFVHHCPTEMTQLELWGCPWSR----RPDGSVN---------------------VRRFGGMKI--------ERTWFAA----------DKTGFHMLHTLF-QT-SLQF--PQ-IQRFDEHFVLDILVD--------D-------G-------HVRGLVA----MN-MMEGTLVQIRANAVVMATGGAGRVYRYNTNGGIVTGDGMGMALSHG-VPLRDMEFVQYHPTGLPGSGI---LMTEGCRGEGGILVNKNGYRYLQDYGMGPETPL------------G-EPKNKYMELGPRDKVSQAFWHEWRK--G--------N--TISTPRGDVVYLDLR-HL--G--EKKL-HERLPFICE-L-AKAYV-GVDPVKEPIPVRPTAHYTMGGIETD----------QNCE---------T---------RIKGLFAVGECSSVGLHGANRLGSNSLAELVVFGRLAGEQATE-----------R-------A---ATAGNGNEAA-------I---E--A------------Q---AA-----G--VEQRLKDLVNQDG------G------E----N----WAKIRDEMGLAMEEGCGI----Y-----RTPE-----LMQKTIDKLAELQERFKRVR----I----T---DTSSVFNTDLLY----------TIELGHGLNVAECMAHSAMARKESRGAHQRLD---------------------------------------------------
11 PsiBlast_PDB 84.3131% 0 - C- -1KF6 FRDA_ECOLI A:[32-537] ---------------------------------KIALISKVYPMRSHTVAAEGGSAAVAQ-----D--HDSFEYHFHDTVAGGDWLCEQDVVDYFVHHCPTEMTQLELWGCPWSR----RPDGSVN---------------------VRRFGGMKI--------ERTWFAA----------DKTGFHMLHTLF-QT-SLQF--PQ-IQRFDEHFVLDILVD--------D-------G-------HVRGLVA----MN-MMEGTLVQIRANAVVMATGGAGRVYRYNTNGGIVTGDGMGMALSHG-VPLRDMEFVQYHPTGLPGSGI---LMTEGCRGEGGILVNKNGYRYLQDYGMGPETPL------------G-EPKNKYMELGPRDKVSQAFWHEWRK--G--------N--TISTPRGDVVYLDLR-HL--G--EKKL-HERLPFICE-L-AKAYV-GVDPVKEPIPVRPTAHYTMGGIETD----------QNCE---------T---------RIKGLFAVGECSSVGLHGANRLGSNSLAELVVFGRLAGEQATE-----------R-------A---ATAGNGNEAA-------I---E--A------------Q---AA-----G--VEQRLKDLVNQDG------G------E----N----WAKIRDEMGLAMEEGCGI----Y-----RTPE-----LMQKTIDKLAELQERFKRVR----I----T---DTSSVFNTDLLY----------TIELGHGLNVAECMAHSAMARKESRGAHQRLD---------------------------------------------------
116 HHSearch 82.2632% 0 - C- -1KF6 FRDA_ECOLI A:[4-559] -----FQADLAIVGAGGAGLRAAIAAAQANPNAKIALISKVYPMRSHTVAAEGGSAAVAQ-----D--HDSFEYHFHDTVAGGDWLCEQDVVDYFVHHCPTEMTQLELWGCPWSR----RPDGSVN---------------------VRRFGGMKI--------ERTWFA-A---------DKTGFHMLHTLF-QT-SL-QF-PQ-IQRFDEHFVLDILVD--------D-------G-------HVRGLVA----MN-MMEGTLVQIRANAVVMATGGAGRVYRYNTNGGIVTGDGMGMALSHG-VPLRDMEFVQYHPTGLPGS---GILMTEGCRGEGGILVNKNGYRY-----LQDYGMGPETPLGEPKNKYM-E-------LGPRDKVSQAFWHEWRK--GNTISTPRGD--V--------VYLDLR-HL--GEKK--L-HERLPFICE-LAKAY-V-GVDPVKEPIPVRPTAHYTMGGIETD----------QNCE---------T---------RIKGLFAVGECSSVGLHGANRLGSNSLAELVVFGRLAGEQATE-----------R-------A---AT----AGNG-------NEAAIEAQAAGVEQR-----L---KDLVN--Q--DGGENWAK---IR------D------E----M----GLAMEEGCGIYRTPELMQKTIDK-----LAEL-----QERFK----------RVRITDTSSV----F---NTD-------LLY---------TIELGHGLNVAECMAHSAMARKESRGAHQRLDEGCTERD---DVNFLKHTLAFRDAD--------------------------
2 PsiBlast_PDB 76.8038% -5 - C1 -1KNP NADB_ECOLI A:[11-520] ---------VLIIGSGAAGLSLALRL-AD--QHQVIVLSKGPVTEGSTFYAQGGIAAVFD-----E--TDSIDSHVEDTLIAGAGICDRHAVEFVASNARSCVQWLIDQGVLFDTHIQPNGEESYH---------------------LTREGGHSH--------RRILHAA----------DATGREVETTLV-SK-ALNH--PN-IRVLERTNAVDLIVS--------D-------KIGLPGTRRVVGAWV----WNRN-KETVETCHAKAVVLATGGASKVYQYTTNPDISSGDGIAMAWRAG-CRVANLEFNQFHPTALYHPQARNFLLTEALRGEGAYLKRPDGTRF-----MPDFDER------------G-E-------LAPRDIVARAIDHEMKRLGA--------D--C--------MFLDISHKP--A--D--FIRQHFPMIYE-K-LLG-L-GIDLTQEPVPIVPAAHYTCGGVMVD----------DHGR---------T---------DVEGLYAIGEVSYTGLHGANLMASNSLLECLVYGWSAAEDITR-----------R-------M---PY----AHDISTLPPWDE---S--R------------V---EN-----P--DERVVIQH---NW------H------E----L----RLFMWDYVGIVRTTKRL-----E-----RALR-----RITML----------QQEID----E----Y---YAH-------FRVSNN------LLELRNLVQVAELIVRCAMMRKESRGLHFTLD--YP-----------------------------------------------
1 PsiBlast_PDB 75.4638% -33 - C1 -1CHU - NADB_ECOLI A:[11-520] ---------VLIIGSGAAGLSLALRL-AD--QHQVIVLSKGPVTE-------------FD-----E--TDSIDSHVEDTLIAGAGICDRHAVEFVASNARSCVQWLIDQGVL-----------------------------------------------------------------------------TTLV-SK-ALNH--PN-IRVLERTNAVDLIVS--------D-------KIGLPGTRRVVGAWV----WNRN-KETVETCHAKAVVLATGGASKVYQYTTNPDISSGDGIAMAWRAG-CRVANLEFNQFHPTALYHPQARNFLLTEALRGEGAYLKRPDGTRF-----MPDFDER------------G-E-------LAPRDIVARAIDHEMKRLGA--------D--C--------MFLDISHKP--A--D--FIRQHFPMIYE-K-LLG-L-GIDLTQEPVPIVPAAHYTCGGVMVD----------DHGR---------T---------DVEGLYAIGEVSYTGLHGANRMASNSLLECLVYGWSAAEDITR-----------R-------M----------HDISTLPPWDE---S--R------------V---EN-----P--DERVVIQH---NW------H------E----L----RLFMWDYVGIVRTTKRL-----E-----RALR-----RITML----------QQEID----E----Y---YAH-------FRVSNN------LLELRNLVQVAELIVRCAMMRKESRGLHFTLD--YP-----------------------------------------------
3 PsiBlast_PDB 75.3338% -10 - C1 -1KNR NADB_ECOLI A:[11-520] ---------VLIIGSGAAGLSLALRL-AD--QHQVIVLSKGPVTEGSTFYAQGGIAAVFD-----E--TDSIDSHVEDTLIAGAGICDRHAVEFVASNARSCVQWLIDQGVLFDTHIQPNGEESYH---------------------LTREGGHSH--------RRILHAA----------DATGREVETTLV-SK-ALNH--PN-IRVLERTNAVDLIVS--------D-------KIGLPGTRRVVGAWV----WNRN-KETVETCHAKAVVLATGGASKVYQYTTNPDISSGDGIAMAWRAG-CRVANLEFNQFHPTALYHPQARNFLLTEALRGEGAYLKRPDGTRF-----MPDFDER------------G-E-------LAPRDIVARAIDHEMKRLGA--------D--C--------MFLDISHKP--A--D--FIRQHFPMIYE-K-LLG-L-GIDLTQEPVPIVPAAHYTCGGVMVD----------DHGR---------T---------DVEGLYAIGEVSYTGLHGANLMASNSLLECLVYGWSAAEDITR-----------R-------M---PY----AHDISTLPPWDE---S--R------------V---EN-----P--DERVVIQH---NW------H------E----L----RLFMWDYVGIVRTTKRL-----E-----RALR-----RITML----------QQEID----E----Y---YAH-------FRVSNN------LLELRNLVQVAELIVRCAMMRKESRGLHFTLD--YP-----------------------------------------------
115 HHSearch 73.4638% -23 - C1 -1CHU - NADB_ECOLI A:[7-532] -----HSCDVLIIGSGAAGLSLALRLADQ--H-QVIVLSKGPVTE-------------FD-----E--TDSIDSHVEDTLIAGAGICDRHAVEFVASNARSCVQWLIDQGVL-----------------------------------------------------------------------------TTLV-SK-AL-NH-PN-IRVLERTNAVDLIVS--------DKIGLPGTR-------RVVGAWV----WN-RNKETVETCHAKAVVLATGGASKVYQYTTNPDISSGDGIAMAWRAG-CRVANLEFNQFHPTALYHPQARNFLLTEALRGEGAYLKRPDGTRF-----MPDFDER------------G-E-------LAPRDIVARAIDHEMKR--LGA------D--C--------MFLDIS-HK--PADF--I-RQHFPMIYE-K-LLG-L-GIDLTQEPVPIVPAAHYTCGGVMVD----------DHGR---------T---------DVEGLYAIGEVSYTGLHGANRMASNSLLECLVYGWSAAEDITR-----------R-------M----------HDI-------ST--LP-PWDESR-------V---EN-----P--DERVVIQH---NW------H------E----L----RLFMWDYVGIVRTTKRLERALRR-----ITML-----QQEID----------E-YYA---------H---FRV-------SNN---------LLELRNLVQVAELIVRCAMMRKESRGLHFTLD--YPELL---T-HSGPSILS-------------------------------
102 Fugue 72.1837% -8 - C1 -1CHU - NADB_ECOLI A:[2-533] NTLPEHSCDVLIIGSGAAGLSLALRL-AD--QHQVIVLSKGPVTEFDE--------------------TDSIDSHVEDTLIAGAGICDRHAVEFVASNARSCVQWLIDQGVL-----------------------------------------------------------------------------TTLV-SK-A--LNHPN-IRVLERTNAVDLIV-SDKIGLPGT-------R-------RVVGAWV----WNRN-KETVETCHAKAVVLATGGASKVYQYTTNPDISSGDGIAMAWRAG-CRVANLEFNQFHPTALYHPQARNFLLTEALRGEGAYLKRPDGTRF-----MPDFDER------------G-E-------LAPRDIVARAIDHEMKR--L--------GADC--------MFLDIS-HKPAD--F--I-RQHFPMIYE-K-LLG--LGIDLTQEPVPIVPAAHYTCGGVMVD----------DHGR---------T---------DVEGLYAIGEVSYTGLHGANRMASNSLLECLVYGWSAAEDITR-----------RMHDISTLP---PW----DESR-------V---E--N---------------------------PDERV-------VIQHNWH------E----L----RLFMWDYVGIVRTTKRLE----R-----ALRR-----ITMLQ----------QEIDE----Y----YAHFRVS-------NN----------LLELRNLVQVAELIVRCAMMRKESRGLHFTLD----YPELLT---HSGPSILSP-----------------------------
21 PsiBlast_CBE 71.5935% -19 - C1 -2E5V NADB_SULTO B:[2-465] ---------IYIIGSGIAGLSAGVAL-RR--AGKKVTLISKRIDGGSTPIAKGGVAASVG-----S--DDSPELHAQDTIRVGDGLCDVKTVNYVTSEAKNVIETFESWGFEFEE----DLR---------------------------LEGGHTK--------RRVLHRT----------DETGREIFNFLL-KL-A--R--EEGIPIIEDRLV-EIRVK--------D-------G-------KVTGFVT----EK-----RGLVEDVDKLVLATGGYSYLYEYSSTQSTNIGDGMAIAFKAG-TILADMEFVQFHPTVTSLDGEVF-LLTETLRGEGAQIINENGERF-----LFNYDKR------------G-E-------LAPRDILSRAIYIEMLK--G--------H--K--------VFIDLS-KI--E--D--F-ERKFPVVAK-Y-LAR-H-GHN-YKVKIPIFPAAHFVDGGIRVN----------IRGE---------S---------NIVNLYAIGEVSDSGLHGANRLASNSLLEGLVFG-------IN-----------L-------P---RY----VDSS-------W---E--G------------I---ST-----DDGIVHSVR-I---SG------NKTLSLKE----I----RRINWENVGIIRNEEKL--------------------------------------------V----K---AIN-------TY----------SSSTQNEAIISYLTALAAEIRKESRGNHFRED--YPYKD---P-NWEKR----------------------------------
4 PsiBlast_PDB 71.4135% -19 - C1 -2E5V NADB_SULTO A:[2-465] ---------IYIIGSGIAGLSAGVAL-RR--AGKKVTLISKRIDGGSTPIAKGGVAASVG-----S--DDSPELHAQDTIRVGDGLCDVKTVNYVTSEAKNVIETFESWGFEFEE----DLR---------------------------LEGGHTK--------RRVLHRT----------DETGREIFNFLL-KL-A--R--EEGIPIIEDRLV-EIRVK--------D-------G-------KVTGFVT----EK-----RGLVEDVDKLVLATGGYSYLYEYSSTQSTNIGDGMAIAFKAG-TILADMEFVQFHPTVTSLDGEVF-LLTETLRGEGAQIINENGERF-----LFNYDKR------------G-E-------LAPRDILSRAIYIEMLK--G--------H--K--------VFIDLS-KI--E--D--F-ERKFPVVAK-Y-LAR-H-GHN-YKVKIPIFPAAHFVDGGIRVN----------IRGE---------S---------NIVNLYAIGEVSDSGLHGANRLASNSLLEGLVFG-------IN-----------L-------P---RY----VDSS-------W---E--G------------I---ST-----DDGIVHSVR-I---SG------NKTLSLKE----I----RRINWENVGIIRNEEKL--------------------------------------------V----K---AIN-------TY----------SSSTQNEAIISYLTALAAEIRKESRGNHFRED--YPYKD---P-NWEKR----------------------------------
112 HHSearch 70.9529% 10 - C1 -2BS2 FRDA_WOLSU A:[4-571] -----QYCDSLVIGGGLAGLRAAVATQQK--GLSTIVLSLIPVKRSHSAAAQGGMQASLGNSKMSD--GDNEDLHFMDTVKGSDWGCDQKVARMFVNTAPKAIRELAAWGVPWTR----IHKGDRMAIINAQKTTITEEDFRHGLIHSRDFGGTKK--------WRTCYT-A---------DATGHTMLFAVA-NE-CL-K--LG-VSIQDRKEAIALIHQ--------D-------G-------KCYGAVV----RD-LVTGDIIAYVAKGTLIATGGYGRIYKNTTNAVVCEGTGTAIALETGIAQLGNMEAVQFHPTPLFPS---GILLTEGCRGDGGILRDVDGHRF-----MPDYEPEK-----------K-E-------LASRDVVSRRMIEHIRK--GKGVQSPYGQ--H--------LWLDIS-IL--GRKH--I-ETNLRDVQE-I-CEYFA-GIDPAEKWAPVLPMQHYSMGGIRTD----------YRGE---------A---------KLKGLFSAGEAACWDMHGFNRLGGNSVSEAVVAGMIVGEYFAE-----------H-------C---AN----TQVDL------ETKTL--EKFVKGQEAYMKSL---VE-----S--KGTEDVFK---IK------N------R----M----KDVMDDNVGIFRDGPHLEKAVKE-----LEEL-----YKKSK----------NVGIK----NKRLHA---NPE-------LEE---------AYRVPMMLKVALCVAKGALDRTESRGAHNRED--YPKRD---DINWLNRTLASWPNP--------------------------
18 PsiBlast_PDB 70.8631% 18 - C1 -4YTM ? A:[65-611] --------------------------------FKTAVVTKMFPTRSHTTAAQGGINAALGSM---N--PDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSR----TPEGKIY---------------------QRSFGGQSN--------N--YGKGGVAKRTCCVADRTGHSMLHTLYGNS-L--R--CH-CTFFIEYFALDLLMD--------K-------G-------RCVGVIA----LCLE-DGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAG-IALEDLEFIQFHPTGIYGVGC---LITEGSRGEGGFLVNSEGERF-----MERYAPK------------AKD-------LASRDVVSRAETIEIME--GRGVGPEK-D--H--------IYLQLH-HL--PAEQ--L-HQRLPGISE-T-AKIFA-GVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGD---------K---------IVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEEL---------K-------PDEKIP----ELPE-------G---A--G------------E---ESIANLDA--VRYANGDV---PT------A------E----LRLTMQKTMQKHAGVFRRGDILA----E-----GVKK-----MMDL-----------FKELK----R----L---KTT-------DRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDD--FPKRE---D-EYDYSKPI---EGQTKRPFEKHWRKHTLTKQ--------
60 PsiBlast_CBE 70.7432% 4 - C1 -3AEG SDHA_PIG A:[43-555] --------------------------------FNTACVTKLFPTRSHTVAAQGGINAALGNM---E--EDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSR----TEDGKIY---------------------QRAFGGQSL--------K--FGKGGQAHRCCCVADRTGHSLLHTLY-GRSL--R--YD-TSYFVEYFALDLLME--------N-------G-------ECRGVIALCIEDG-S-IHRIRARN---TVVATGGYGRTYFSCTSAHTSTGDGTAMVTRAG-LPCQDLEFVQFHPTGIYGAGC---LITEGCRGEGGILINSQGERF-----MERYAPV------------AKD-------LASRDVVSRSMTLEIRE--GRGCGPEK-D--H--------VYLQLH-HL--PPEQ--L-AVRLPGISE-T-AMIFA-GVDVTKEPIPVLPTVHYNMGGIPTN----------YKGQ---------VLRHVNGQDQVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCRPGDKVPSIK-------P---NA----GEES-------V---M--N------------L---DK-----L--RFAN-GTI---RT------S------E----LRLSMQKSMQSHAAVFRVGSVLQ----EGCEKILRLYGDLQHLKTFD----------RGMVW----N----T---DL--------VE----------TLELQNLMLCALQTIYGAEARKESRGAHARED--F------------------------------------------------
19 PsiBlast_PDB 70.7431% 19 - C1 -4YTN ? A:[65-611] --------------------------------FKTAVVTKMFPTRSHTTAAQGGINAALGSM---N--PDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSR----TPEGKIY---------------------QRSFGGQSN--------N--YGKGGVAKRTCCVADRTGHSMLHTLYGNS-L--R--CH-CTFFIEYFALDLLMD--------K-------G-------RCVGVIA----LCLE-DGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAG-IALEDLEFIQFHPTGIYGVGC---LITEGSRGEGGFLVNSEGERF-----MERYAPK------------AKD-------LASRDVVSRAETIEIME--GRGVGPEK-D--H--------IYLQLH-HL--PAEQ--L-HQRLPGISE-T-AKIFA-GVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGD---------K---------IVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEEL---------K-------PDEKIP----ELPE-------G---A--G------------E---ESIANLDA--VRYANGDV---PT------A------E----LRLTMQKTMQKHAGVFRRGDILA----E-----GVKK-----MMDL-----------FKELK----R----L---KTT-------DRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDD--FPKRE---D-EYDYSKPI---EGQTKRPFEKHWRKHTLTKQ--------
117 HHSearch 70.6636% -7 - C1 -2E5V NADB_SULTO A:[1-470] --------MIYIIGSGIAGLSAGVALRRA--GKKVTLISKRI-DGGSTPIAKGGVAASVG-----S--DDSPELHAQDTIRVGDGLCDVKTVNYVTSEAKNVIETFESWGFEFEE----DL---------------------------RLEGGHTK--------RRVLHR-T---------DETGREIFNFLL-KL-AR-E--EG-IPIIED-RLVEIRVK--------D-------G-------KVTGFVT----EK---RG--LVEDVDKLVLATGGYSYLYEYSSTQSTNIGDGMAIAFKAG-TILADMEFVQFHPTVTSLDG-EVFLLTETLRGEGAQIINENGERF-----LFNYDKR------------G-E-------LAPRDILSRAIYIEMLK--G--------H--K--------VFIDLS-KI--E--D--F-ERKFPVVAK-Y-LAR-H-GHNYK-VKIPIFPAAHFVDGGIRVN----------IRGE---------S---------NIVNLYAIGEVSDSGLHGANRLASNSLLEGLVFGINLPRYVDS-----------S-------W---EG----ISTD-------D---G--I------------V---HS-----V--RISGNKTL---SL------K------E----I----RRINWENVGIIRNEEKLVK---A-----INTY-----SSS-------------------------------------------------------TQNEAIISYLTALAAEIRKESRGNHFRED--YPYKD---P-NWEKRIYFKL-----------------------------