@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PA3050: (2016-02-13 )
MYTLARQLLFKLSPETSHELSIDLIGAGGRLGLNRLLTPKPASLPVSVLGLEFPNPVGLAAGLDKNGDAIDGFGQLGFGFIEIGTVTPRPQPGNPRPRLFRLPQANAIINRMGFNNHGVDHLLARVRAAKYRGVLGINIGKNFDTPVERAVDDYLICLDKVYADASYVTVNVSSPNTPGLRSLQFGDSLKQLLEALRQRQEALALRHGRRVPLAIKIAPDMTDEETALVAAALVEAGMDAVIATNTTLGREGVEGLPHGDEAGGLSGAPVREKSTHTVKVLAGELGGRLPIIAAGGITEGAHAAEKIAAGASLVQIYSGFIYKGPALIREAVDAIAALPRRN

Atome Classification :

(55 SA) ---------....-.....10........20........30....-....40........50........60..-......70......-..80........90.--.......100....-...110.......120----........---------130--..---------..--------.....140.......150.......160.......170.......180.......190......------.-----------200..---.....210-..-.....220.......230.......240.......250-...-----.....260.......270.......280.......290.......300.......310.......320.......330.......340---------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) ---------MYTL-ARQLLFKLSPETSHELSIDLIGAGGRLGLNR-LLTPKPASLPVSVLGLEFPNPVGLAAGL-DKNGDAIDGFGQLG-FGFIEIGTVTPRPQP--GNPRPRLFRLPQAN-AIINRMGFNNHGVDH-----LLARVRAA---------K----YR---------GV--------LGINIGKNFDTPVERAVDDYLICLDKVYADASYVTVNVSSPNTPGLRSLQFGDSLKQLLEALRQ------R-----------QEALA---LRHGRRVP-LA-IKIAPDMTDEETALVAAALVEAGMDAVIATNTTLGR-E-GVE-----GLPHGDEAGGLSGAPVREKSTHTVKVLAGELGGRLPIIAAGGITEGAHAAEKIAAGASLVQIYSGFIYKGPALIREAVDAIAALPRRN---------------
65 HHSearch 92.0657% -88 - C1 -1F76 PYRD_ECOLI A:[1-336] ---------MYYPFVRKALFQLDPERAHEFTFQQLRRITGTPFEALVRQ-KVPAKPVNCMGLTFKNPLGLAAGL-DKDGECIDALGAMG-FGSIEIGTVTPRPQP--GNDKPRLFRLVDAE-GLINRMGFNNLGVDN-----LVENVKKA---------H----YD---------GV--------LGINIGKNKDTPVEQGKDDYLICMEKIYAYAGYIAINISSPNTPGLRTLQYGEALDDLLTAIKN------K-----------QNDLQ---AMHHKYVP-IA-VKIAPDLSEEELIQVADSLVRHNIDGVIATNTTLDR-S-LVQ-----GMKNCDQTGGLSGRPLQLKSTEIIRRLSLELNGRLPIIGVGGIDSVIAAREKIAAGASLVQIYSGFIFKGPPLIKEIVTHI----------------------
1 PsiBlast_PDB 91.1856% -89 - C1 -1F76 PYRD_ECOLI A:[3-336] ----------YPF-VRKALFQLDPERAHEFTFQQLRRITGTPFEA-LVRQKVPAKPVNCMGLTFKNPLGLAAGL-DKDGECIDALGAMG-FGSIEIGTVTPRPQP--GNDKPRLFRLVDAE-GLINRMGFNNLGVDN-----LVENVKKA---------H----YD---------GV--------LGINIGKNKDTPVEQGKDDYLICMEKIYAYAGYIAINISSPNTPGLRTLQYGEALDDLLTAIKN------K-----------QNDLQ---AMHHKYVP-IA-VKIAPDLSEEELIQVADSLVRHNIDGVIATNTTLDR-S-LVQ-----GMKNCDQTGGLSGRPLQLKSTEIIRRLSLELNGRLPIIGVGGIDSVIAAREKIAAGASLVQIYSGFIFKGPPLIKEIVTHI----------------------
29 PsiBlast_CBE 79.3944% -82 - C1 -4JGD PYRD_HUMAN A:[44-371] ---------------------LDPESAHRLAVRFTSLGL---LPR-ARFQDSDMLEVRVLGHKFRNPVGIAAGF-DKHGEAVDGLYKMG-FGFVEIGSVTPKPQE--GNPRPRVFRLPEDQ-AVINRYGFNSHGLSV-----VEHRLRAR---------Q----QK---------QAKLTEDGLPLGVNLGKN-KTSVD-AAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQ------E-----------RDGLR---RVH--RPA-VL-VKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPA-GLQ-----GALRS-ETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEAL-------------------
18 PsiBlast_PDB 78.9144% -79 - C1 -3U2O PYRD_HUMAN A:[49-376] ---------------------LDPESAHRLAVRFTSLGL---LPR-ARFQDSDMLEVRVLGHKFRNPVGIAAGF-DKHGEAVDGLYKMG-FGFVEIGSVTPKPQE--GNPRPRVFRLPEDQ-AVINRYGFNSHGLSV-----VEHRLRAR---------Q----QK---------QAKLTEDGLPLGVNLGKN-KTSVD-AAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQ------E-----------RDGLR---RVH--RPA-VL-VKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPA-GLQ-----GALR-SETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEAL-------------------
3 PsiBlast_PDB 78.8844% -85 - C1 -1UUO PYRD_RAT A:[26-353] ---------------------LDPESAHRLAVRVTSLGL---LP-----QDSDMLEVKVLGHKFRNPVGIAAGF-DKNGEAVDGLYKLG-FGFVEVGSVTPQPQE--GNPRPRVFRLPEDQ-AVINRYGFNSHGLSV-----VEHRLRAR---------Q----QK---------QAQLTADGLPLGINLGKNKTS--EDAAADYAEGVRTLGPLADYLVVNVSSP--------QGKTELRHLLSKVLQ------E-----------RD--A---LKGTRKPA-VL-VKIAPDLTAQDKEDIASVARELGIDGLIVTNTTVSR-PVGLQ-----GALR-SETGGLSGKPLRDLSTQTIREMYALTQGRIPIIGVGGVSSGQDALEKIQAGASLVQLYTALIFLGPPVVVRVKRELEAL-------------------
34 PsiBlast_CBE 77.3644% -81 - C1 -3KVJ PYRD_HUMAN A:[44-371] ---------------------LDPESAHRLAVRFTSLGL---LPR-ARFQDSDMLEVRVLGHKFRNPVGIAAGF-DKHGEAVDGLYKMG-FGFVEIGSVTPKPQE--GNPRPRVFRLPEDQ-AVINRYGFNSHGLSV-----VEHRLRAR---------Q----QK---------QAKLTEDGLPLGVNLGKN-KTSVD-AAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQ------E-----------RDGLR---RVH--RPA-VL-VKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPA-GLQ-----GALRS-ETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEAL-------------------
24 PsiBlast_CBE 77.3444% -81 - C1 -4LS0 PYRD_HUMAN A:[44-371] ---------------------LDPESAHRLAVRFTSLGL---LPR-ARFQDSDMLEVRVLGHKFRNPVGIAAGF-DKHGEAVDGLYKMG-FGFVEIGSVTPKPQE--GNPRPRVFRLPEDQ-AVINRYGFNSHGLSV-----VEHRLRAR---------Q----QK---------QAKLTEDGLPLGVNLGKN-KTSVD-AAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQ------E-----------RDGLR---RVH--RPA-VL-VKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPA-GLQ-----GALRS-ETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEAL-------------------
22 PsiBlast_CBE 77.2944% -80 - C1 -4LS2 PYRD_HUMAN A:[44-371] ---------------------LDPESAHRLAVRFTSLGL---LPR-ARFQDSDMLEVRVLGHKFRNPVGIAAGF-DKHGEAVDGLYKMG-FGFVEIGSVTPKPQE--GNPRPRVFRLPEDQ-AVINRYGFNSHGLSV-----VEHRLRAR---------Q----QK---------QAKLTEDGLPLGVNLGKN-KTSVD-AAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQ------E-----------RDGLR---RVH--RPA-VL-VKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPA-GLQ-----GALRS-ETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEAL-------------------
33 PsiBlast_CBE 77.1844% -83 - C1 -3KVK PYRD_HUMAN A:[44-371] ---------------------LDPESAHRLAVRFTSLGL---LPR-ARFQDSDMLEVRVLGHKFRNPVGIAAGF-DKHGEAVDGLYKMG-FGFVEIGSVTPKPQE--GNPRPRVFRLPEDQ-AVINRYGFNSHGLSV-----VEHRLRAR---------Q----QK---------QAKLTEDGLPLGVNLGKN-KTSVD-AAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQ------E-----------RDGLR---RVH--RPA-VL-VKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPA-GLQ-----GALRS-ETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEAL-------------------
20 PsiBlast_PDB 77.1344% -88 - C1 -4OQV PYRD_HUMAN A:[18-345] ---------------------LDPESAHRLAVRFTSLGL---LPR-ARFQDSDMLEVRVLGHKFRNPVGIAAGF-DKHGEAVDGLYKMG-FGFVEIGSVTPKPQE--GNPRPRVFRLPEDQ-AVINRYGFNSHGLSV-----VEHRLRAR---------Q----QK---------QAKLTEDGLPLGVNLGKN-KTSVD-AAEDYAEGVRVLGPLADYLVVNVSSP---------GKAELRRLLTKVLQ------E-----------RDGLR---RVH--RPA-VL-VKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPA-GLQ-----GALR-SETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEAL-------------------
6 PsiBlast_PDB 76.9744% -79 - C1 -1D3H PYRD_HUMAN A:[21-348] ---------------------LDPESAHRLAVRFTSLGL---LP----FQDSDMLEVRVLGHKFRNPVGIAAGF-DKHGEAVDGLYKMG-FGFVEIGSVTPKPQE--GNPRPRVFRLPEDQ-AVINRYGFNSHGLSV-----VEHRLRAR---------Q----QK---------QAKLTEDGLPLGVNLGKN-KTSVD-AAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQ------E-----------RDGLR---RVH--RPA-VL-VKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPA-GLQ-----GALR-SETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEAL-------------------
8 PsiBlast_PDB 76.7844% -88 - C1 -2PRH PYRD_HUMAN A:[21-348] ---------------------LDPESAHRLAVRFTSLGL---LPR-ARFQDSDMLEVRVLGHKFRNPVGIAAGF-DKHGEAVDGLYKMG-FGFVEIGSVTPKPQE--GNPRPRVFRLPEDQ-AVINRYGFNSHGLSV-----VEHRLRAR---------Q----QK---------QAKLTEDGLPLGVNLGKN-KTSVD-AAEDYAEGVRVLGPLADYLVVNVSSP---------GKAELRRLLTKVLQ------E-----------RDGLR---RVH--RPA-VL-VKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPA-GLQ-----GALR-SETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEAL-------------------
26 PsiBlast_CBE 76.7744% -81 - C1 -4JTT PYRD_HUMAN A:[44-371] ---------------------LDPESAHRLAVRFTSLGL---LPR-ARFQDSDMLEVRVLGHKFRNPVGIAAGF-DKHGEAVDGLYKMG-FGFVEIGSVTPKPQE--GNPRPRVFRLPEDQ-AVINRYGFNSHGLSV-----VEHRLRAR---------Q----QK---------QAKLTEDGLPLGVNLGKN-KTSVD-AAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQ------E-----------RDGLR---RVH--RPA-VL-VKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPA-GLQ-----GALRS-ETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEAL-------------------
15 PsiBlast_PDB 76.7744% -80 - C1 -3G0X PYRD_HUMAN A:[21-348] ---------------------LDPESAHRLAVRFTSLGL---LP----FQDSDMLEVRVLGHKFRNPVGIAAGF-DKHGEAVDGLYKMG-FGFVEIGSVTPKPQE--GNPRPRVFRLPEDQ-AVINRYGFNSHGLSV-----VEHRLRAR---------Q----QK---------QAKLTEDGLPLGVNLGKN-KTSVD-AAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQ------E-----------RDGLR---RVH--RPA-VL-VKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPA-GLQ-----GALR-SETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEAL-------------------