@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu02770: (2016-06-04 )
MDQTRTLGKTKLKVKRIGFGANAVGGHNLFPNLNDETGKDLVRTALDGGVNFIDTAFIYGLGRSEELIGEVVQERGVRNELIIATKGAHKEVDGSIELDNSREFLRSEVEKSLKRLKTDYIDLYYVHFPDGKTPLAEVAGTLKELKDEGKIKAIGASNLDYQQLQDFNADGYLEVFQAEYSLIQRDAEKELLPYCEKQGISFIPYFPLASGLLTGKFTQDTVFDDFRKDKPQFQGETFIHNLKKVDKLKAVAEEKQADTAHVALAWLLTRPAIDAIIPGAKRPEQLQDNLKTLNIELTEDEVNFISDIFK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAP_A_3(1PZ1)
GS69_BACSU
[Raw transfer]




NAP_A_3(1PZ1)
GS69_BACSU
[Raw transfer]




NAP_A_3(1PZ0)
IOLS_BACSU
[Raw transfer]




GOL_A_6(3O0K)
?
[Raw transfer]




1 PsiBlast_PDB 93.0353% -98 - C5 -1PYF - IOLS_BACSU -
2 PsiBlast_PDB 92.7153% -96 - C5 -1PZ0 8.9 IOLS_BACSU
60 HHSearch 92.6653% -93 - C5 -1PYF - IOLS_BACSU -
4 PsiBlast_PDB 79.7835% -96 - C5 -3N2T - ? -
3 PsiBlast_PDB 78.7439% -95 - C5 -1PZ1 10.9 GS69_BACSU
59 HHSearch 78.1537% -91 - C5 -1PZ1 10.9 GS69_BACSU
61 HHSearch 77.3834% -92 - C5 -3N2T - ? -
22 PsiBlast_CBE 77.0031% -89 - C5 -4AUB - GPR_ECOLI -
25 PsiBlast_CBE 74.8831% -89 - C5 -4AUB - GPR_ECOLI -
70 HHSearch 74.6830% -98 * C5 *3ERP - ? -
19 PsiBlast_PDB 74.4026%-104 - C5 -4JTA - KCAB2_RAT -
20 PsiBlast_PDB 74.3326%-102 - C5 -4JTC - KCAB2_RAT -
50 Fugue 74.3027% -93 - C5 -1QRQ - KCAB2_RAT -
29 PsiBlast_CBE 74.2831% -91 - C5 -3N6Q - GPR_ECOLI -
24 PsiBlast_CBE 74.2231% -93 - C5 -4AUB - GPR_ECOLI -
26 PsiBlast_CBE 74.0931% -91 - C5 -4AUB - GPR_ECOLI -
15 PsiBlast_PDB 74.0726% -98 - C5 -1QRQ - KCAB2_RAT -
17 PsiBlast_PDB 74.0626%-104 - C5 -2R9R - KCAB2_RAT -
12 PsiBlast_PDB 74.0126% -99 - C5 -3EB3 - KCAB2_RAT -
7 PsiBlast_PDB 74.0032%-105 - C5 -3UYI - PERR_RAUSE -