@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu24470: (2016-07-08 )
MPHFLILNGPNVNRLGSREPEVFGRQTLTDIETDLFQFAEALHIQLTFFQSNHEGDLIDAIHEAEEQYSGIVLNPGALSHYSYAIRDAVSSISLPVVEVHLSNLYAREEFRHQSVIAPVAKGQIVGLGAEGYKLAVRYLLSQQGGESR

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TRS_L_(1GU1)
AROQ_STRCO
[Raw transfer]




139 HHSearch 97.52100%-162 - C8 -1GQO - AROQ_BACSU -
1 PsiBlast_PDB 97.51100%-162 - C8 -1GQO - AROQ_BACSU -
21 PsiBlast_CBE 96.80100%-157 - C8 -1GQO - AROQ_BACSU -
41 PsiBlast_CBE 96.02100%-155 - C8 -1GQO - AROQ_BACSU -
43 PsiBlast_CBE 95.83100%-154 - C8 -1GQO - AROQ_BACSU -
28 PsiBlast_CBE 95.74100%-155 - C8 -1GQO - AROQ_BACSU -
23 PsiBlast_CBE 93.94100%-159 - C8 -1GQO - AROQ_BACSU -
46 PsiBlast_CBE 81.9952%-162 - C8 -1UQR - AROQ_ACTPL -
52 PsiBlast_CBE 81.1952%-160 - C8 -1UQR - AROQ_ACTPL -
45 PsiBlast_CBE 81.1952%-157 - C8 -1UQR - AROQ_ACTPL -
51 PsiBlast_CBE 80.8452%-160 - C8 -1UQR - AROQ_ACTPL -
2 PsiBlast_PDB 80.1652%-154 - C8 -1UQR - AROQ_ACTPL -
44 PsiBlast_CBE 80.0952%-158 - C8 -1UQR - AROQ_ACTPL -
53 PsiBlast_CBE 79.6052%-156 - C8 -1UQR - AROQ_ACTPL -
147 HHSearch 79.4644%-154 - C8 -3N8K - AROQ_MYCTU -
78 PsiBlast_CBE 79.3147%-117 - C8 -2BT4 - AROQ_STRCO -
142 HHSearch 78.9550%-149 - C8 -1UQR - AROQ_ACTPL -
124 PsiBlast_CBE 78.8447%-112 - C8 -1D0I - AROQ_STRCO -
66 PsiBlast_CBE 78.7247%-118 - C8 -2CJF - AROQ_STRCO -
54 PsiBlast_CBE 78.4552%-159 - C8 -1UQR - AROQ_ACTPL -
101 PsiBlast_CBE 76.8447%-111 - C8 -1GU1 3.3 AROQ_STRCO