@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00106_DHI1_H: (2014-08-27 )
MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK

Atome Classification :

(61 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAP_B_7(3D3E)
DHI1_HUMAN
[Raw transfer]




NAP_C_9(3D5Q)
DHI1_HUMAN
[Raw transfer]




NDP_C_10(4HX5)
DHI1_HUMAN
[Raw transfer]




NAP_A_5(3CH6)
DHI1_HUMAN
[Raw transfer]




NAP_B_7(3OQ1)
DHI1_HUMAN
[Raw transfer]




NAP_B_6(3PDJ)
DHI1_HUMAN
[Raw transfer]




NAP_B_5(3FRJ)
DHI1_HUMAN
[Raw transfer]




NAP_E_11(3TFQ)
DHI1_HUMAN
[Raw transfer]




NDP_D_12(4HX5)
DHI1_HUMAN
[Raw transfer]




NDP_B_8(4HX5)
DHI1_HUMAN
[Raw transfer]




NAP_A_5(3D4N)
DHI1_HUMAN
[Raw transfer]




NDP_A_6(3QQP)
DHI1_HUMAN
[Raw transfer]




NAP_C_9(3OQ1)
DHI1_HUMAN
[Raw transfer]




NDP_A_6(4HX5)
DHI1_HUMAN
[Raw transfer]




NAP_B_5(3FCO)
DHI1_HUMAN
[Raw transfer]




NAP_A_3(4BB6)
DHI1_HUMAN
[Raw transfer]




NDP_D_11(1XU7)
DHI1_HUMAN
[Raw transfer]




NAP_A_5(3BZU)
DHI1_HUMAN
[Raw transfer]




NAP_D_11(4BB5)
DHI1_HUMAN
[Raw transfer]




NDP_C_10(3QQP)
DHI1_HUMAN
[Raw transfer]




NDP_D_8(1XU9)
DHI1_HUMAN
[Raw transfer]




NAP_A_5(4BB5)
DHI1_HUMAN
[Raw transfer]




NAP_C_9(3H6K)
DHI1_HUMAN
[Raw transfer]




NAP_A_5(3OQ1)
DHI1_HUMAN
[Raw transfer]




NAP_A_5(3D5Q)
DHI1_HUMAN
[Raw transfer]




NDP_A_5(1XU7)
DHI1_HUMAN
[Raw transfer]




NDP_C_9(1XU7)
DHI1_HUMAN
[Raw transfer]




NDP_B_6(1XU9)
DHI1_HUMAN
[Raw transfer]




NDP_A_5(1XU9)
DHI1_HUMAN
[Raw transfer]




NAP_D_11(3OQ1)
DHI1_HUMAN
[Raw transfer]




NAP_C_9(4BB5)
DHI1_HUMAN
[Raw transfer]




NAP_A_5(3D3E)
DHI1_HUMAN
[Raw transfer]




NAP_A_5(3TFQ)
DHI1_HUMAN
[Raw transfer]




NAP_B_7(4BB5)
DHI1_HUMAN
[Raw transfer]




NAP_A_3(3FCO)
DHI1_HUMAN
[Raw transfer]




NAP_A_3(3CZR)
DHI1_HUMAN
[Raw transfer]




NAP_A_4(3PDJ)
DHI1_HUMAN
[Raw transfer]




NDP_D_12(3QQP)
DHI1_HUMAN
[Raw transfer]




NDP_B_7(1XU7)
DHI1_HUMAN
[Raw transfer]




NAP_B_6(4BB6)
DHI1_HUMAN
[Raw transfer]




NAP_A_3(3FRJ)
DHI1_HUMAN
[Raw transfer]




NAP_C_9(3D3E)
DHI1_HUMAN
[Raw transfer]




NDP_C_7(1XU9)
DHI1_HUMAN
[Raw transfer]




NAP_C_9(3BZU)
DHI1_HUMAN
[Raw transfer]




NAP_B_7(3BZU)
DHI1_HUMAN
[Raw transfer]




NAP_B_7(3D4N)
DHI1_HUMAN
[Raw transfer]




NAP_B_4(3CZR)
DHI1_HUMAN
[Raw transfer]




NAP_C_10(3HFG)
DHI1_HUMAN
[Raw transfer]




NAP_A_6(3HFG)
DHI1_HUMAN
[Raw transfer]




NDP_B_8(3QQP)
DHI1_HUMAN
[Raw transfer]




NDP_C_3(1XSE)
DHI1_CAVPO
[Raw transfer]




NAP_D_11(3BZU)
DHI1_HUMAN
[Raw transfer]




NAP_C_9(3D4N)
DHI1_HUMAN
[Raw transfer]




NAP_D_11(3D3E)
DHI1_HUMAN
[Raw transfer]




NAP_D_12(3HFG)
DHI1_HUMAN
[Raw transfer]




NDP_A_5(3BYZ)
DHI1_HUMAN
[Raw transfer]




NAP_B_7(3D5Q)
DHI1_HUMAN
[Raw transfer]




NAP_D_11(3H6K)
DHI1_HUMAN
[Raw transfer]




NAP_A_5(3H6K)
DHI1_HUMAN
[Raw transfer]




NAP_B_7(3H6K)
DHI1_HUMAN
[Raw transfer]




NAP_D_11(3D5Q)
DHI1_HUMAN
[Raw transfer]




HD2_C_10(4BB5)
DHI1_HUMAN
[Raw transfer]




HD2_B_8(4BB5)
DHI1_HUMAN
[Raw transfer]




HD2_A_6(4BB5)
DHI1_HUMAN
[Raw transfer]




HD1_A_4(4BB6)
DHI1_HUMAN
[Raw transfer]




HD2_D_12(4BB5)
DHI1_HUMAN
[Raw transfer]




HD1_B_7(4BB6)
DHI1_HUMAN
[Raw transfer]




19V_A_5(4HX5)
DHI1_HUMAN
[Raw transfer]




S05_C_9(3QQP)
DHI1_HUMAN
[Raw transfer]




S05_D_11(3QQP)
DHI1_HUMAN
[Raw transfer]




3PJ_A_3(3PDJ)
DHI1_HUMAN
[Raw transfer]




S05_A_5(3QQP)
DHI1_HUMAN
[Raw transfer]




D3E_B_8(3D3E)
DHI1_HUMAN
[Raw transfer]




IIG_A_4(3FCO)
DHI1_HUMAN
[Raw transfer]




19V_C_9(4HX5)
DHI1_HUMAN
[Raw transfer]




A49_B_4(3FRJ)
DHI1_HUMAN
[Raw transfer]




D3E_A_6(3D3E)
DHI1_HUMAN
[Raw transfer]




CPS_B_5(3CZR)
DHI1_HUMAN
[Raw transfer]




CPS_A_9(1XU9)
DHI1_HUMAN
[Raw transfer]




S05_B_7(3QQP)
DHI1_HUMAN
[Raw transfer]




07M_E_12(3TFQ)
DHI1_HUMAN
[Raw transfer]




311_A_6(3CH6)
DHI1_HUMAN
[Raw transfer]




T30_A_6(3D5Q)
DHI1_HUMAN
[Raw transfer]




D3E_C_10(3D3E)
DHI1_HUMAN
[Raw transfer]




D3E_D_12(3D3E)
DHI1_HUMAN
[Raw transfer]




T30_C_10(3D5Q)
DHI1_HUMAN
[Raw transfer]




07M_A_6(3TFQ)
DHI1_HUMAN
[Raw transfer]




H11_A_9(3BYZ)
DHI1_HUMAN
[Raw transfer]




D4N_B_8(3D4N)
DHI1_HUMAN
[Raw transfer]




17R_A_5(3HFG)
DHI1_HUMAN
[Raw transfer]




17R_C_9(3HFG)
DHI1_HUMAN
[Raw transfer]




A21_C_10(3BZU)
DHI1_HUMAN
[Raw transfer]




D4N_A_6(3D4N)
DHI1_HUMAN
[Raw transfer]




33T_A_6(3H6K)
DHI1_HUMAN
[Raw transfer]




A21_B_8(3BZU)
DHI1_HUMAN
[Raw transfer]




A21_D_12(3BZU)
DHI1_HUMAN
[Raw transfer]




A21_A_6(3BZU)
DHI1_HUMAN
[Raw transfer]




D4N_C_10(3D4N)
DHI1_HUMAN
[Raw transfer]




33T_C_10(3H6K)
DHI1_HUMAN
[Raw transfer]




3OQ_B_8(3OQ1)
DHI1_HUMAN
[Raw transfer]




3OQ_A_12(3OQ1)
DHI1_HUMAN
[Raw transfer]




MES_A_13(1XU9)
DHI1_HUMAN
[Raw transfer]




19 PsiBlast_PDB 96.7798%-139 - C1 -3TFQ 13.5 DHI1_HUMAN
25 PsiBlast_CBE 96.3799%-138 - C1 -3PDJ 12.8 DHI1_HUMAN
60 PsiBlast_CBE 96.2198%-139 - C1 -3TFQ 13.2 DHI1_HUMAN
18 PsiBlast_PDB 95.9798%-136 - C1 -3CH6 12.2 DHI1_HUMAN
53 PsiBlast_CBE 95.8999%-135 - C1 -1XU9 13.0 DHI1_HUMAN
29 PsiBlast_CBE 95.8899%-138 - C1 -3QQP 12.8 DHI1_HUMAN
16 PsiBlast_PDB 95.8599%-138 - C1 -4HX5 13.2 DHI1_HUMAN
3 PsiBlast_PDB 95.5099%-136 - C1 -3PDJ 13.4 DHI1_HUMAN
31 PsiBlast_CBE 95.4299%-136 - C1 -3QQP 12.3 DHI1_HUMAN
71 HHSearch 94.99100%-132 - C1 -1XU9 12.8 DHI1_HUMAN
10 PsiBlast_PDB 94.9899%-135 - C1 -3FRJ 13.1 DHI1_HUMAN
55 PsiBlast_CBE 94.7699%-134 - C1 -1XU7 13.3 DHI1_HUMAN
27 PsiBlast_CBE 94.7599%-134 - C1 -4HX5 12.9 DHI1_HUMAN
12 PsiBlast_PDB 94.5899%-132 - C1 -3FCO 12.2 DHI1_HUMAN
7 PsiBlast_PDB 94.3799%-132 - C1 -3CZR 12.4 DHI1_HUMAN
48 PsiBlast_CBE 94.1699%-139 - C1 -3BZU 12.8 DHI1_HUMAN
30 PsiBlast_CBE 94.1699%-135 - C1 -3QQP 13.0 DHI1_HUMAN
42 PsiBlast_CBE 94.1399%-133 - C1 -3D4N 13.1 DHI1_HUMAN
33 PsiBlast_CBE 94.1099%-131 - C1 -3OQ1 12.6 DHI1_HUMAN
59 PsiBlast_CBE 94.0699%-134 - C1 -3D5Q 12.7 DHI1_HUMAN
56 PsiBlast_CBE 94.0199%-134 - C1 -1XU7 13.0 DHI1_HUMAN
28 PsiBlast_CBE 93.9899%-136 - C1 -4HX5 13.2 DHI1_HUMAN
23 PsiBlast_CBE 93.9898%-132 - C1 -4BB5 13.1 DHI1_HUMAN
26 PsiBlast_CBE 93.9699%-136 - C1 -4HX5 13.3 DHI1_HUMAN
50 PsiBlast_CBE 93.9099%-134 - C1 -3BZU 13.0 DHI1_HUMAN
15 PsiBlast_PDB 93.8499%-134 - C1 -3QQP 12.8 DHI1_HUMAN
6 PsiBlast_PDB 93.7299%-132 - C1 -3BZU 12.7 DHI1_HUMAN
21 PsiBlast_CBE 93.6898%-133 - C1 -4BB5 12.8 DHI1_HUMAN
49 PsiBlast_CBE 93.5599%-134 - C1 -3BZU 13.0 DHI1_HUMAN
38 PsiBlast_CBE 93.4599%-133 - C1 -3H6K 12.3 DHI1_HUMAN
32 PsiBlast_CBE 93.4199%-138 - C1 -3OQ1 12.4 DHI1_HUMAN
43 PsiBlast_CBE 93.3999%-136 - C1 -3D4N 12.9 DHI1_HUMAN
41 PsiBlast_CBE 93.2899%-133 - C1 -3FCO 12.0 DHI1_HUMAN
13 PsiBlast_PDB 93.2799%-132 - C1 -3H6K 12.5 DHI1_HUMAN
1 PsiBlast_PDB 93.2498%-135 - C1 -4BB5 12.9 DHI1_HUMAN
9 PsiBlast_PDB 93.2299%-132 - C1 -3D4N 13.1 DHI1_HUMAN
11 PsiBlast_PDB 93.0099%-133 - C1 -3HFG 12.7 DHI1_HUMAN
51 PsiBlast_CBE 92.9799%-133 - C1 -1XU9 12.9 DHI1_HUMAN
39 PsiBlast_CBE 92.9799%-135 - C1 -3H6K 12.4 DHI1_HUMAN
22 PsiBlast_CBE 92.8298%-135 - C1 -4BB5 12.7 DHI1_HUMAN
20 PsiBlast_PDB 92.7999%-137 - C1 -3BYZ 12.5 DHI1_HUMAN
4 PsiBlast_PDB 92.6899%-131 - C1 -1XU7 13.2 DHI1_HUMAN
54 PsiBlast_CBE 92.5799%-131 - C1 -1XU7 13.0 DHI1_HUMAN
34 PsiBlast_CBE 92.5699%-133 - C1 -3OQ1 12.0 DHI1_HUMAN
40 PsiBlast_CBE 92.4699%-134 - C1 -3FRJ 13.0 DHI1_HUMAN
58 PsiBlast_CBE 92.1299%-132 - C1 -3D5Q 12.9 DHI1_HUMAN
8 PsiBlast_PDB 92.0199%-131 - C1 -3D3E 12.4 DHI1_HUMAN
17 PsiBlast_PDB 91.8799%-131 - C1 -3D5Q 12.3 DHI1_HUMAN
37 PsiBlast_CBE 91.8599%-133 - C1 -3H6K 12.5 DHI1_HUMAN
52 PsiBlast_CBE 91.8399%-131 - C1 -1XU9 13.4 DHI1_HUMAN
46 PsiBlast_CBE 91.4999%-132 - C1 -3D3E 13.1 DHI1_HUMAN
45 PsiBlast_CBE 91.3699%-133 - C1 -3D3E 13.1 DHI1_HUMAN
24 PsiBlast_CBE 91.3198%-135 - C1 -4BB6 13.3 DHI1_HUMAN
44 PsiBlast_CBE 90.8699%-131 - C1 -3D3E 12.4 DHI1_HUMAN
2 PsiBlast_PDB 90.7898%-128 - C1 -4BB6 13.2 DHI1_HUMAN
14 PsiBlast_PDB 90.4399%-132 - C1 -3OQ1 11.7 DHI1_HUMAN
57 PsiBlast_CBE 90.2899%-133 - C1 -3D5Q 11.9 DHI1_HUMAN
61 Fugue 90.2173%-134 - C1 -1XSE 12.4 DHI1_CAVPO
36 PsiBlast_CBE 90.0399%-131 - C1 -3HFG 13.1 DHI1_HUMAN
47 PsiBlast_CBE 89.8199%-131 - C1 -3CZR 13.1 DHI1_HUMAN
35 PsiBlast_CBE 88.8899%-130 - C1 -3HFG 11.4 DHI1_HUMAN