@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : GPR1_HUMAN: (2016-01-10 )
MEDLEETLFEEFENYSYDLDYYSLESDLEEKVQLGVVHWVSLVLYCLAFVLGIPGNAIVIWFTGFKWKKTVTTLWFLNLAIADFIFLLFLPLYISYVAMNFHWPFGIWLCKANSFTAQLNMFASVFFLTVISLDHYIHLIHPVLSHRHRTLKNSLIVIIFIWLLASLIGGPALYFRDTVEFNNHTLCYNNFQKHDPDLTLIRHHVLTWVKFIIGYLFPLLTMSICYLCLIFKVKKRSILISSRHFWTILVVVVAFVVCWTPYHLFSIWELTIHHNSYSHHVMQAGIPLSTGLAFLNSCLNPILYVLISKKFQARFRSSVAEILKYTLWEVSCSGTVSEQLRNSETKNLCLLETAQ

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OLC_A_10(4XNV)
P2RY1_HUMAN
[Raw transfer]



OLC_A_4(5C1M)
?
[Raw transfer]
47 Fugue 91.7728%-152 - C4 -4XNV - P2RY1_HUMAN (first) -
22 PsiBlast_CBE 88.5032%-162 - C4 -4RWA - OPRD_HUMAN -
21 PsiBlast_CBE 88.3932%-158 - C4 -4RWD - OPRD_HUMAN -
4 PsiBlast_PDB 88.0632%-158 - C4 -4RWD - C562_ECOLX (first) -
5 PsiBlast_PDB 87.4632%-163 - C4 -4N6H - OPRD_HUMAN -
3 PsiBlast_PDB 87.3132%-161 - C4 -4RWA - C562_ECOLX (first) -
6 PsiBlast_PDB 85.7623%-160 - C4 -4XNV 3.3 P2RY1_HUMAN
7 PsiBlast_PDB 83.7523%-161 - C4 -4XNW - RUBR_CLOPA -
28 HHSearch 83.3426%-155 - C4 -3ODU - CXCR4_HUMAN (first) -
1 PsiBlast_PDB 83.1530%-160 - C4 -4EA3 - C562_ECOLX (first) -
30 HHSearch 82.6224%-143 - C4 -3UON - ACM2_HUMAN (first) -
19 PsiBlast_PDB 80.8822%-159 - C4 -4MBS - CCR5_HUMAN (first) -
9 PsiBlast_PDB 80.3927%-159 - C4 -4XT3 - US28_HCMVA -
2 PsiBlast_PDB 77.9731%-166 - C4 -5C1M 3.6 ?
37 HHSearch 77.9222%-147 - C4 -3PBL - DRD3_HUMAN (first) -
35 HHSearch 77.1923%-140 - C4 -2KS9 - NK1R_HUMAN -
34 HHSearch 77.0821%-144 - C4 -3RZE - ENLYS_BPT4 (first) -
33 HHSearch 76.8722%-146 * C4 *2Z73 - OPSD_TODPA -
8 PsiBlast_PDB 76.7127%-157 - C4 -4XT1 - US28_HCMVA -
18 PsiBlast_PDB 75.5228%-145 - C4 -2LNL - CXCR1_HUMAN -