@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : MK14_HUMAN: (2013-07-23 )
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES

Atome Classification :

(80 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

KQ7_A_2(3KQ7)
MK14_HUMAN
[Raw transfer]




L51_A_3(3HV4)
MK14_HUMAN
[Raw transfer]




P40_A_2(3DT1)
MK14_HUMAN
[Raw transfer]




R24_A_3(3HV5)
MK14_HUMAN
[Raw transfer]




6NP_C_3(1YQJ)
MK14_HUMAN
[Raw transfer]




R24_B_6(3HV5)
MK14_HUMAN
[Raw transfer]




I2O_A_2(3RIN)
MK14_HUMAN
[Raw transfer]




B96_B_2(1KV2)
MK14_HUMAN
[Raw transfer]




L51_B_7(3HV4)
MK14_HUMAN
[Raw transfer]




P37_A_2(3GFE)
MK14_HUMAN
[Raw transfer]




R39_A_3(3HV6)
MK14_HUMAN
[Raw transfer]




GK1_A_3(2ZAZ)
MK14_HUMAN
[Raw transfer]




P66_A_2(3ITZ)
MK14_HUMAN
[Raw transfer]




N3F_A_3(3QUD)
MK14_HUMAN
[Raw transfer]




GK3_A_2(2ZB0)
MK14_HUMAN
[Raw transfer]




FKL_A_2(3FKL)
MK14_HUMAN
[Raw transfer]




LHJ_A_2(3LHJ)
MK14_HUMAN
[Raw transfer]




GK4_A_2(2ZB1)
MK14_HUMAN
[Raw transfer]




FLZ_A_2(3FLZ)
MK14_HUMAN
[Raw transfer]




06F_A_2(3UVR)
MK14_HUMAN
[Raw transfer]




048_A_2(3UVP)
MK14_HUMAN
[Raw transfer]




1N1_A_2(3LFA)
MK14_HUMAN
[Raw transfer]




5JZ_A_2(3HA8)
MK14_HUMAN
[Raw transfer]




0OO_A_3(4EH7)
MK14_HUMAN
[Raw transfer]




1AU_A_2(3HV7)
MK14_HUMAN
[Raw transfer]




RO6_A_2(3FSK)
MK14_HUMAN
[Raw transfer]




09J_A_2(3U8W)
MK14_HUMAN
[Raw transfer]




FMJ_A_2(3FMJ)
MK14_HUMAN
[Raw transfer]




2A8_A_2(3ZYA)
MK14_HUMAN
[Raw transfer]




B11_C_3(1ZZ2)
MK14_HUMAN
[Raw transfer]




0OK_A_3(4EH2)
MK14_HUMAN
[Raw transfer]




1GK_A_2(3MPT)
MK14_HUMAN
[Raw transfer]




0OM_A_3(4EH5)
MK14_HUMAN
[Raw transfer]




FPH_A_2(1OZ1)
MK14_HUMAN
[Raw transfer]




P36_A_2(3HP2)
MK14_HUMAN
[Raw transfer]




SB2_A_2(2EWA)
MK14_MOUSE
[Raw transfer]




084_C_3(1OUK)
MK14_HUMAN
[Raw transfer]




GG5_A_2(3HVC)
MK14_HUMAN
[Raw transfer]




MSQ_B_2(1DI9)
MK14_HUMAN
[Raw transfer]




F4C_A_2(3K3J)
MK14_HUMAN
[Raw transfer]




FSS_A_2(3FSF)
MK14_HUMAN
[Raw transfer]




0ON_A_3(4EH6)
MK14_HUMAN
[Raw transfer]




I47_A_2(3HL7)
MK14_HUMAN
[Raw transfer]




533_A_2(3FMH)
MK14_HUMAN
[Raw transfer]




0OL_A_3(4EH4)
MK14_HUMAN
[Raw transfer]




891_A_2(3FLQ)
MK14_HUMAN
[Raw transfer]




JBI_A_2(3TTJ)
MK10_HUMAN
[Raw transfer]




MIH_A_2(3MW1)
MK14_HUMAN
[Raw transfer]




ANP_A_5(4IC7)
MK07_HUMAN
[Raw transfer]




NAR_A_2(4EH3)
MK14_HUMAN
[Raw transfer]




ADP_A_4(2B9H)
FUS3_YEAST
[Raw transfer]




L9G_A_2(3KF7)
MK14_HUMAN
[Raw transfer]




BMU_A_2(1KV1)
MK14_HUMAN
[Raw transfer]




094_A_2(1OUY)
MK14_HUMAN
[Raw transfer]




I45_A_2(3HLL)
MK14_HUMAN
[Raw transfer]




I39_A_2(3HRB)
MK14_HUMAN
[Raw transfer]




PQB_A_2(2GFS)
MK14_HUMAN
[Raw transfer]




FLY_A_2(3FLY)
MK14_HUMAN
[Raw transfer]




FLW_A_2(3FLW)
MK14_HUMAN
[Raw transfer]




52P_A_2(3HP5)
MK14_HUMAN
[Raw transfer]




3FF_A_4(3QUE)
MK14_HUMAN
[Raw transfer]




R4L_A_2(4B99)
MK07_HUMAN
[Raw transfer]




DQO_A_3(1M7Q)
MK14_HUMAN
[Raw transfer]




0OP_A_3(4EH8)
MK14_HUMAN
[Raw transfer]




FML_A_2(3FML)
MK14_HUMAN
[Raw transfer]




FLS_A_2(3FLS)
MK14_HUMAN
[Raw transfer]




BMU_A_2(3O8U)
MK14_HUMAN
[Raw transfer]




29A_A_2(3ROC)
MK14_HUMAN
[Raw transfer]




2CH_A_2(1WBO)
MK14_HUMAN
[Raw transfer]




FL4_A_2(3FL4)
MK14_HUMAN
[Raw transfer]




530_A_2(3FMN)
MK14_HUMAN
[Raw transfer]




0OQ_A_3(4EH9)
MK14_HUMAN
[Raw transfer]




FKN_A_2(3FKN)
MK14_HUMAN
[Raw transfer]




0SJ_A_2(4EHV)
MK14_HUMAN
[Raw transfer]




SB4_B_2(1BL7)
MK14_HUMAN
[Raw transfer]




SB6_B_2(1BL6)
MK14_HUMAN
[Raw transfer]




SB2_B_2(1A9U)
MK14_HUMAN
[Raw transfer]




EDO_A_6(3ZDU)
CDKL3_HUMAN
[Raw transfer]




44 PsiBlast_CBE 99.01100%-135 - C1 -1WBO 3.0 MK14_HUMAN
88 PsiBlast_CBE 96.41100%-134 - C1 -4EH2 4.1 MK14_HUMAN
16 PsiBlast_PDB 96.37100%-134 - C1 -1BL7 8.2 MK14_HUMAN
99 PsiBlast_CBE 96.22100%-138 - C1 -3HV5 11.7 MK14_HUMAN
13 PsiBlast_PDB 96.03100%-134 - C1 -3ZYA 8.7 MK14_HUMAN
101 PsiBlast_CBE 96.01100%-137 - C1 -3HV4 10.6 MK14_HUMAN
63 PsiBlast_CBE 95.73100%-133 - C1 -3FMJ 5.8 MK14_HUMAN
36 PsiBlast_CBE 95.73100%-131 - C1 -2ZB1 8.1 MK14_HUMAN
82 PsiBlast_CBE 95.69100%-134 - C1 -4EH8 4.3 MK14_HUMAN
37 PsiBlast_CBE 95.62100%-131 - C1 -2ZB0 8.3 MK14_HUMAN
80 PsiBlast_CBE 95.40100%-133 - C1 -4EHV 6.1 MK14_HUMAN
100 PsiBlast_CBE 95.31100%-135 - C1 -3HV4 10.6 MK14_HUMAN
76 PsiBlast_CBE 95.30100%-135 - C1 -3MW1 8.0 MK14_HUMAN
97 PsiBlast_CBE 95.23100%-135 - C1 -3HV6 9.3 MK14_HUMAN
11 PsiBlast_PDB 95.22100%-131 - C1 -3ITZ 10.0 MK14_HUMAN
35 PsiBlast_CBE 95.10100%-136 - C1 -3HL7 7.4 MK14_HUMAN
34 PsiBlast_CBE 95.06100%-131 - C1 -3HLL 8.3 MK14_HUMAN
19 PsiBlast_PDB 95.06100%-135 - C1 -3HA8 10.6 MK14_HUMAN
98 PsiBlast_CBE 95.01100%-135 - C1 -3HV5 11.9 MK14_HUMAN
10 PsiBlast_PDB 94.90100%-130 - C1 -3GFE 9.7 MK14_HUMAN
12 PsiBlast_PDB 94.88100%-135 - C1 -3LHJ 9.5 MK14_HUMAN
77 PsiBlast_CBE 94.85100%-130 - C1 -3HRB 7.2 MK14_HUMAN
65 PsiBlast_CBE 94.81100%-130 - C1 -3FLZ 6.7 MK14_HUMAN
56 PsiBlast_CBE 94.77100%-134 - C1 -3HVC 6.0 MK14_HUMAN
29 PsiBlast_CBE 94.74100%-131 - C1 -3RIN 10.0 MK14_HUMAN
20 PsiBlast_PDB 94.68100%-132 - C1 -3K3J 9.0 MK14_HUMAN
83 PsiBlast_CBE 94.64100%-130 - C1 -4EH7 4.6 MK14_HUMAN
52 PsiBlast_CBE 94.64100%-129 - C1 -1DI9 5.0 MK14_HUMAN
84 PsiBlast_CBE 94.62100%-134 - C1 -4EH6 4.4 MK14_HUMAN
71 PsiBlast_CBE 94.61100%-130 - C1 -3FKN 8.4 MK14_HUMAN
87 PsiBlast_CBE 94.60100%-132 - C1 -4EH3 5.5 MK14_HUMAN
38 PsiBlast_CBE 94.56100%-133 - C1 -2ZAZ 6.3 MK14_HUMAN
15 PsiBlast_PDB 94.53100%-130 - C1 -1BL6 5.3 MK14_HUMAN
55 PsiBlast_CBE 94.50100%-129 - C1 -3MPT 5.4 MK14_HUMAN
3 PsiBlast_PDB 94.50100%-129 - C1 -1OUY 8.2 MK14_HUMAN
60 PsiBlast_CBE 94.47100%-136 - C1 -3FSF 5.9 MK14_HUMAN
73 PsiBlast_CBE 94.45100%-131 - C1 -2GFS 6.4 MK14_HUMAN
67 PsiBlast_CBE 94.45100%-131 - C1 -3FLW 7.5 MK14_HUMAN
59 PsiBlast_CBE 94.44100%-133 - C1 -3FSK 5.7 MK14_HUMAN
92 PsiBlast_CBE 94.43100%-134 - C1 -3UVP 8.7 MK14_HUMAN
33 PsiBlast_CBE 94.38100%-127 - C1 -3HP2 8.3 MK14_HUMAN
66 PsiBlast_CBE 94.36100%-131 - C1 -3FLY 7.4 MK14_HUMAN
68 PsiBlast_CBE 94.33100%-133 - C1 -3FLS 7.4 MK14_HUMAN
94 PsiBlast_CBE 94.23100%-128 - C1 -3QUD 7.6 MK14_HUMAN
17 PsiBlast_PDB 94.18100%-129 - C1 -2EWA 8.3 MK14_MOUSE
70 PsiBlast_CBE 94.07100%-136 - C1 -3FL4 8.1 MK14_HUMAN
61 PsiBlast_CBE 94.07100%-131 - C1 -3FMN 6.8 MK14_HUMAN
18 PsiBlast_PDB 94.06100%-130 - C1 -1A9U 6.9 MK14_HUMAN
31 PsiBlast_CBE 94.02100%-131 - C1 -3KF7 9.4 MK14_HUMAN
4 PsiBlast_PDB 93.99100%-129 - C1 -1YQJ 10.0 MK14_HUMAN
74 PsiBlast_CBE 93.93100%-133 - C1 -1OZ1 7.0 MK14_HUMAN
28 PsiBlast_CBE 93.88100%-130 - C1 -3ROC 7.9 MK14_HUMAN
95 PsiBlast_CBE 93.86100%-136 - C1 -3LFA 6.5 MK14_HUMAN
39 PsiBlast_CBE 93.86100%-132 - C1 -1ZZ2 8.1 MK14_HUMAN
89 PsiBlast_CBE 93.79100%-128 - C1 -4DLJ - MK14_HUMAN
14 PsiBlast_PDB 93.79100%-130 - C1 -3U8W 9.8 MK14_HUMAN
85 PsiBlast_CBE 93.72100%-131 - C1 -4EH5 3.9 MK14_HUMAN
64 PsiBlast_CBE 93.64100%-129 - C1 -3FMH 8.1 MK14_HUMAN
72 PsiBlast_CBE 93.57100%-127 - C1 -3FKL 10.0 MK14_HUMAN
57 PsiBlast_CBE 93.5099%-135 - C1 -3O8U 7.3 MK14_HUMAN
53 PsiBlast_CBE 93.43100%-125 - C1 -3DT1 7.9 MK14_HUMAN
32 PsiBlast_CBE 93.42100%-132 - C1 -3HP5 8.9 MK14_HUMAN
62 PsiBlast_CBE 93.34100%-133 - C1 -3FML 6.1 MK14_HUMAN
2 PsiBlast_PDB 93.32100%-124 - C1 -1OUK 8.9 MK14_HUMAN
86 PsiBlast_CBE 93.29100%-131 - C1 -4EH4 4.5 MK14_HUMAN
96 PsiBlast_CBE 93.28100%-130 - C1 -3HV7 9.6 MK14_HUMAN
81 PsiBlast_CBE 93.22100%-130 - C1 -4EH9 5.3 MK14_HUMAN
91 PsiBlast_CBE 93.06100%-132 - C1 -3UVR 12.5 MK14_HUMAN
93 PsiBlast_CBE 93.03100%-123 - C1 -3QUE 8.2 MK14_HUMAN
54 PsiBlast_CBE 92.80100%-129 - C1 -3KQ7 10.9 MK14_HUMAN
1 PsiBlast_PDB 92.79100%-127 - C1 -1M7Q 7.2 MK14_HUMAN
69 PsiBlast_CBE 92.73100%-129 - C1 -3FLQ 6.7 MK14_HUMAN
51 PsiBlast_CBE 91.69100%-127 - C1 -1KV1 6.9 MK14_HUMAN
111 HHSearch 91.3799%-133 * C1 *2FST - MK14_HUMAN
50 PsiBlast_CBE 90.85100%-127 - C1 -1KV2 11.3 MK14_HUMAN
117 HHSearch 75.0449%-125 - C1 -3TTJ 8.5 MK10_HUMAN
125 HHSearch 69.8047%-117 - C1 -2B9H 5.0 FUS3_YEAST
113 HHSearch 69.6447%-123 - C1 -4B99 6.5 MK07_HUMAN
114 HHSearch 66.5446%-119 - C1 -4IC7 5.2 MK07_HUMAN
121 HHSearch 44.3434%-112 - C1 -3ZDU 2.8 CDKL3_HUMAN