@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : new_query: (2014-05-07 )
LSCGDVATQLAPCINYLRSAGPLPPACCNGVKNLKNSAATTQDRRTACKCLINASKSISGVNFGLAAGLPGKCGVNIPYKISPSTNCD

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]



DAO_E_5(2ALG)
NLTP1_PRUPE
[Raw transfer]
12 HHSearch 93.2561%-125 - C3 -1T12 - NLTP1_TOBAC -
13 HHSearch 91.9660%-127 - C3 -2ALG 3.5 NLTP1_PRUPE
32 SP3 91.1755%-125 - C3 -1FK5 5.5 NLTP_MAIZE
14 HHSearch 89.0456%-119 - C3 -1SIY - NLTP1_VIGRR -
11 HHSearch 87.4956%-122 - C3 -1AFH - NLTP_MAIZE -
16 HHSearch 81.3740%-122 - C3 -1BWO - NLTP1_WHEAT -
26 HHSearch 63.4530%-133 - C3 -1SM7 - ? -
29 HHSearch 58.8425%-160 * C3 *1HSS - IAA1_WHEAT -
23 HHSearch 52.3724%-131 - C3 -1BEA - ITRF_MAIZE -
9 Fugue 50.8323%-103 - C3 -1S6D - 2SS8_HELAN -
28 HHSearch 50.4723%-106 - C3 -1S6D - 2SS8_HELAN -
17 HHSearch 49.5725%-108 - C3 -2RKN - DIRL1_ARATH -
2 Fugue 48.2626% -81 - C3 -2RKN - DIRL1_ARATH -
30 HHSearch 47.0523% -92 - C3 -2LVF - ? -
31 HHSearch 45.5017% -90 - C3 -1W2Q - CONG_ARAHY -
22 HHSearch 45.4317%-123 - C3 -1B1U - IAAT_ELECO -
3 Fugue 40.9725% -94 - C3 -1L6H - NLTPX_ORYSJ -
10 Fugue 40.8821% -55 - C3 -1PSY - 2SS_RICCO -
36 SP3 40.7915% -84 * C4 *1QPO - NADC_MYCTU -
24 HHSearch 40.2424% -63 - C3 -1PSY - 2SS_RICCO -


User Run . : Multi Template Modeling Result:

(4 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]



DAO_E_5(2ALG)
NLTP1_PRUPE
[Raw transfer]
47 96.22100%-148 - C- -M047 - -
44 93.98100%-133 - C- -M044 - -
45 93.83100%-143 - C- -M045 - -
46 92.54100%-137 - C- -M046 - -