@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 535_tII_MAIZE: (2014-05-10 )
QQCSAAQLAACAPAIISGSPPTASCCSNLRAQEPCFCQYARNPAYSSYINSPNARRTLASCGIAVPSC

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
1 HHSearch 90.5263%-124 - C2 -1N89 6.2 NLT2G_WHEAT
2 HHSearch 80.9857%-130 - C2 -1L6H - NLTPX_ORYSJ -
28 SP3 80.7257%-130 - C2 -1L6H - NLTPX_ORYSJ -
18 Fugue 80.7257%-130 - C2 -1L6H - NLTPX_ORYSJ -
19 Fugue 76.3432%-101 - C2 -2RKN - DIRL1_ARATH -
3 HHSearch 72.8828%-115 - C2 -2RKN - DIRL1_ARATH -
5 HHSearch 65.8230% -91 - C2 -1SIY - NLTP1_VIGRR -
9 HHSearch 64.9730%-103 - C2 -1T12 - NLTP1_TOBAC -
8 HHSearch 64.3631% -95 - C2 -1AFH - NLTP_MAIZE -
29 SP3 62.5129% -80 - C2 -1FK5 - NLTP_MAIZE -
31 SP3 60.4822% -84 - C2 -1KNG - CYCY_BRADU -
7 HHSearch 56.8332% -93 - C2 -2ALG - NLTP1_PRUPE -
4 HHSearch 56.7525% -66 - C2 -1BWO - NLTP1_WHEAT -
10 HHSearch 52.9027%-109 - C2 -1HYP - HPSE_SOYBN -
22 Fugue 47.6613% -93 - C2 -1S6D - 2SS8_HELAN -
30 SP3 45.3910% -92 - C2 -1U78 - TC3A_CAEEL -
36 SP3 44.4811%-101 * C2 *1TC3 - TC3A_CAEEL -
34 SP3 43.5716% -69 - C2 -1LU4 - -
24 Fugue 42.5313% -79 - C2 -2CKX - ? -
33 SP3 40.9816% -91 - C2 -1F9M - TRXF_SPIOL -


User Run . : Multi Template Modeling Result:

(3 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
43 93.87100%-121 - C- -M043 - -
42 91.36100%-117 - C- -M042 - -
45 91.31100%-118 - C- -M045 - -