@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Z_NR1C2_PPARb2: (2016-04-07 )
AMCRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYERCERACKVQKKSRNKCQYCRFQKCLALGMSHDAIRYGRMPEAEKKKLVAGLLAGENPQSSSGTDLKTLAKHVNTAYLRNLNMTKKRARSILTGKTSCTAPFVIHDMDSLWQAENGLVWNQLNGAPLNKEIGVHVFYRCQCTTVETVRELTEFAKNIPGFVDLFLNDQVTLLKYGVHEAIFAMLPSLMNKDGLLVANGKGFVTREFLRSLRKPFSEIMEPKFEFAVKFNALELDDSDLALFVAAIILCGDRPGLMNVKQVEQIQDGILQALDQHLQVHHPDSSHLFPKLLQKMADLRQLVTENAQLVQMIKKTESETSLHPLLQEIYRDLY

Atome Classification :

(172 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

IL2_B_4(3SP9)
PPARD_HUMAN
[Raw transfer]




IL2_A_3(3SP9)
PPARD_HUMAN
[Raw transfer]




S44_A_2(2ZNN)
PPARA_HUMAN
[Raw transfer]




3EQ_B_10(3PEQ)
PPARD_HUMAN
[Raw transfer]




3EQ_A_3(3PEQ)
PPARD_HUMAN
[Raw transfer]




2PQ_A_3(3GBK)
PPARG_HUMAN
[Raw transfer]




IL2_A_3(3SP6)
PPARA_HUMAN
[Raw transfer]




VCA_A_7(2B50)
PPARD_HUMAN
[Raw transfer]




L41_B_4(3D5F)
PPARD_HUMAN
[Raw transfer]




L41_A_3(3D5F)
PPARD_HUMAN
[Raw transfer]




VCA_B_8(2B50)
PPARD_HUMAN
[Raw transfer]




VCA_E_5(2AWH)
PPARD_HUMAN
[Raw transfer]




5BC_A_3(3NOA)
PPARG_HUMAN
[Raw transfer]




VCA_F_6(2AWH)
PPARD_HUMAN
[Raw transfer]




5BC_B_4(3NOA)
PPARG_HUMAN
[Raw transfer]




VCA_F_6(2BAW)
PPARD_HUMAN
[Raw transfer]




K55_A_4(2ZNP)
PPARD_HUMAN
[Raw transfer]




Y1N_A_2(4CI4)
PPARA_HUMAN
[Raw transfer]




401_B_6(2ZNQ)
PPARD_HUMAN
[Raw transfer]




24L_A_3(3V9Y)
PPARG_HUMAN
[Raw transfer]




3EA_D_4(2ATH)
PPARG_HUMAN
[Raw transfer]




13M_A_2(3VI8)
PPARA_HUMAN
[Raw transfer]




401_A_4(2ZNQ)
PPARD_HUMAN
[Raw transfer]




S44_A_3(2ZNO)
PPARG_HUMAN
[Raw transfer]




DRD_A_3(2HWR)
PPARG_HUMAN
[Raw transfer]




13M_A_2(3VI8)
PPARA_HUMAN
[Raw transfer]




GW0_A_2(3TKM)
PPARD_HUMAN
[Raw transfer]




735_C_3(2P54)
PPARA_HUMAN
[Raw transfer]




K55_B_6(2ZNP)
PPARD_HUMAN
[Raw transfer]




3OZ_A_2(3OZ0)
PPARD_HUMAN
[Raw transfer]




EK1_A_3(3VSO)
PPARG_HUMAN
[Raw transfer]




UNT_A_3(3IA6)
PPARG_HUMAN
[Raw transfer]




ET1_B_7(3ET2)
PPARD_HUMAN
[Raw transfer]




DRJ_C_3(2I4J)
PPARG_HUMAN
[Raw transfer]




3EA_C_3(2ATH)
PPARG_HUMAN
[Raw transfer]




4HD_A_3(2VV1)
PPARG_HUMAN
[Raw transfer]




RO7_A_3(3G9E)
PPARG_HUMAN
[Raw transfer]




208_A_3(2GTK)
PPARG_HUMAN
[Raw transfer]




331_N_14(1Y0S)
PPARD_HUMAN
[Raw transfer]




AZ2_C_3(1I7I)
PPARG_HUMAN
[Raw transfer]




331_O_15(1Y0S)
PPARD_HUMAN
[Raw transfer]




5HE_A_3(2VV2)
PPARG_HUMAN
[Raw transfer]




XCX_A_3(3R8I)
PPARG_HUMAN
[Raw transfer]




CTM_A_3(3FEI)
PPARA_HUMAN
[Raw transfer]




L92_A_3(2Q8S)
PPARG_HUMAN
[Raw transfer]




9HO_A_3(2VSR)
PPARG_HUMAN
[Raw transfer]




RO7_A_3(3G8I)
PPARA_HUMAN
[Raw transfer]




M7S_A_3(3AN3)
PPARG_HUMAN
[Raw transfer]




CTM_A_3(3FEJ)
PPARG_HUMAN
[Raw transfer]




ET1_A_3(3ET3)
PPARG_HUMAN
[Raw transfer]




C01_C_3(1ZEO)
PPARG_HUMAN
[Raw transfer]




LRG_A_3(3B3K)
PPARG_HUMAN
[Raw transfer]




M7R_A_3(3AN4)
PPARG_HUMAN
[Raw transfer]




DRH_A_3(2I4Z)
PPARG_HUMAN
[Raw transfer]




AZ2_D_4(1I7I)
PPARG_HUMAN
[Raw transfer]




5OX_A_3(3X1H)
PPARG_HUMAN
[Raw transfer]




Y1N_A_3(4CI5)
PPARG_HUMAN
[Raw transfer]




ET1_A_5(3ET1)
PPARA_HUMAN
[Raw transfer]




UNT_B_4(3IA6)
PPARG_HUMAN
[Raw transfer]




ET1_A_3(3ET2)
PPARD_HUMAN
[Raw transfer]




ZZH_A_3(3HOD)
PPARG_HUMAN
[Raw transfer]




ET1_B_6(3ET1)
PPARA_HUMAN
[Raw transfer]




240_B_4(2Q59)
PPARG_HUMAN
[Raw transfer]




EK8_A_3(3VSP)
PPARG_HUMAN
[Raw transfer]




EHA_C_3(2F4B)
PPARG_HUMAN
[Raw transfer]




DY6_B_5(3DY6)
PPARD_HUMAN
[Raw transfer]




TLS_A_3(3VN2)
PPARG_HUMAN
[Raw transfer]




WY1_A_4(4BCR)
PPARA_HUMAN
[Raw transfer]




F22_A_3(2VV0)
PPARG_HUMAN
[Raw transfer]




ZAA_A_2(3BC5)
PPARG_HUMAN
[Raw transfer]




GRR_A_3(3CDS)
PPARG_HUMAN
[Raw transfer]




14R_X_3(4HEE)
PPARG_HUMAN
[Raw transfer]




DY6_A_4(3DY6)
PPARD_HUMAN
[Raw transfer]




IMN_A_4(3ADX)
PPARG_HUMAN
[Raw transfer]




IMN_A_4(3ADS)
PPARG_HUMAN
[Raw transfer]




1FA_A_3(2Q5G)
PPARD_HUMAN
[Raw transfer]




YRG_A_3(3CDP)
PPARG_HUMAN
[Raw transfer]




WLM_B_6(2XYJ)
PPARD_HUMAN
[Raw transfer]




J35_A_3(3VJH)
PPARG_HUMAN
[Raw transfer]




DRY_A_3(2HWQ)
PPARG_HUMAN
[Raw transfer]




DKD_A_3(3HO0)
PPARG_HUMAN
[Raw transfer]




WLM_A_3(2XYJ)
PPARD_HUMAN
[Raw transfer]




LRG_A_3(4L98)
PPARG_HUMAN
[Raw transfer]




538_D_6(3KMG)
PPARG_HUMAN
[Raw transfer]




6OC_A_3(2VV4)
PPARG_HUMAN
[Raw transfer]




RRG_A_4(4E4K)
PPARG_HUMAN
[Raw transfer]




MYI_A_4(3ADU)
PPARG_HUMAN
[Raw transfer]




3JX_D_4(4R2U)
PPARG_HUMAN
[Raw transfer]




LRG_A_2(4L96)
PPARG_HUMAN
[Raw transfer]




LNA_A_5(3CWD)
PPARG_HUMAN
[Raw transfer]




08S_A_3(2XYW)
PPARD_HUMAN
[Raw transfer]




4R8_A_3(2VV3)
PPARG_HUMAN
[Raw transfer]




GW4_A_3(2POB)
PPARG_HUMAN
[Raw transfer]




NSI_D_4(2HFP)
PPARG_HUMAN
[Raw transfer]




OCX_A_3(2ZK3)
PPARG_HUMAN
[Raw transfer]




0W3_A_3(4FGY)
PPARG_HUMAN
[Raw transfer]




538_A_5(3KMG)
PPARG_HUMAN
[Raw transfer]




17L_A_3(3V9T)
PPARG_HUMAN
[Raw transfer]




08S_B_5(2XYW)
PPARD_HUMAN
[Raw transfer]




PTG_A_3(2ZVT)
PPARG_HUMAN
[Raw transfer]




D30_D_6(3H0A)
PPARG_HUMAN
[Raw transfer]




LRG_B_4(4L98)
PPARG_HUMAN
[Raw transfer]




3JX_A_3(4R2U)
PPARG_HUMAN
[Raw transfer]




21L_A_3(3V9V)
PPARG_HUMAN
[Raw transfer]




66B_A_3(3X1I)
PPARG_HUMAN
[Raw transfer]




GW9_B_4(3B0R)
PPARG_HUMAN
[Raw transfer]




Z00_B_5(2XYX)
PPARD_HUMAN
[Raw transfer]




486_A_3(3QT0)
PPARG_HUMAN
[Raw transfer]




HIG_A_3(3R8A)
PPARG_HUMAN
[Raw transfer]




Z00_A_3(2XYX)
PPARD_HUMAN
[Raw transfer]




LNA_B_7(3CWD)
PPARG_HUMAN
[Raw transfer]




LRG_A_3(3D6D)
PPARG_HUMAN
[Raw transfer]




M0T_A_3(3S9S)
PPARG_HUMAN
[Raw transfer]




CEK_A_3(3LMP)
PPARG_HUMAN
[Raw transfer]




RO0_C_3(2FVJ)
PPARG_HUMAN
[Raw transfer]




SF2_A_3(2Q6R)
PPARG_HUMAN
[Raw transfer]




3K2_A_3(4R6S)
PPARG_HUMAN
[Raw transfer]




SF2_B_4(2Q6R)
PPARG_HUMAN
[Raw transfer]




1FA_B_4(2Q5G)
PPARD_HUMAN
[Raw transfer]




243_B_4(2VST)
PPARG_HUMAN
[Raw transfer]




MLO_A_3(3R5N)
PPARG_HUMAN
[Raw transfer]




YFE_A_3(2YFE)
PPARG_HUMAN
[Raw transfer]




YFD_A_3(4A4V)
PPARG_HUMAN
[Raw transfer]




EPA_B_4(3GWX)
PPARD_HUMAN
[Raw transfer]




241_A_3(2Q5P)
PPARG_HUMAN
[Raw transfer]




SF1_A_4(2Q61)
PPARG_HUMAN
[Raw transfer]




HIG_B_4(3R8A)
PPARG_HUMAN
[Raw transfer]




T9T_B_4(3WJ5)
PPARG_HUMAN
[Raw transfer]




ZXG_A_3(3PBA)
PPARG_HUMAN
[Raw transfer]




XPT_B_4(3PO9)
PPARG_HUMAN
[Raw transfer]




4HD_B_4(2VV1)
PPARG_HUMAN
[Raw transfer]




T9T_A_3(3WJ5)
PPARG_HUMAN
[Raw transfer]




SP0_C_3(2G0G)
PPARG_HUMAN
[Raw transfer]




243_A_3(2VST)
PPARG_HUMAN
[Raw transfer]




5OX_B_4(3X1H)
PPARG_HUMAN
[Raw transfer]




TBY_A_3(3WJ4)
PPARG_HUMAN
[Raw transfer]




FCM_A_3(4F9M)
PPARG_HUMAN
[Raw transfer]




NRO_B_4(2ZK5)
PPARG_HUMAN
[Raw transfer]




SP3_D_4(2G0H)
PPARG_HUMAN
[Raw transfer]




KRC_A_3(3B1M)
PPARG_HUMAN
[Raw transfer]




NZA_A_4(2Q5S)
PPARG_HUMAN
[Raw transfer]




471_K_11(1KKQ)
PPARA_HUMAN
[Raw transfer]




TBY_B_4(3WJ4)
PPARG_HUMAN
[Raw transfer]




SP3_C_3(2G0H)
PPARG_HUMAN
[Raw transfer]




PTG_A_3(2ZK1)
PPARG_HUMAN
[Raw transfer]




Z12_A_3(3FUR)
PPARG_HUMAN
[Raw transfer]




MYI_B_7(3ADU)
PPARG_HUMAN
[Raw transfer]




IMN_B_5(3ADX)
PPARG_HUMAN
[Raw transfer]




471_L_12(1KKQ)
PPARA_HUMAN
[Raw transfer]




PTG_A_4(2ZK2)
PPARG_HUMAN
[Raw transfer]




Z27_B_5(3K8S)
PPARG_HUMAN
[Raw transfer]




471_J_10(1KKQ)
PPARA_HUMAN
[Raw transfer]




YFD_B_4(4A4V)
PPARG_HUMAN
[Raw transfer]




PTG_B_4(2ZK1)
PPARG_HUMAN
[Raw transfer]




GW9_D_12(3E00)
PPARG_HUMAN
[Raw transfer]




F22_B_4(2VV0)
PPARG_HUMAN
[Raw transfer]




LU2_B_5(3SZ1)
PPARG_HUMAN
[Raw transfer]




471_I_9(1KKQ)
PPARA_HUMAN
[Raw transfer]




WY1_B_8(4BCR)
PPARA_HUMAN
[Raw transfer]




XDI_A_3(3OSW)
PPARG_HUMAN
[Raw transfer]




OCX_B_4(2ZK3)
PPARG_HUMAN
[Raw transfer]




CTI_A_3(4Y29)
?
[Raw transfer]




HID_A_4(3ADT)
PPARG_HUMAN
[Raw transfer]




MYI_A_3(3ADW)
PPARG_HUMAN
[Raw transfer]




MSZ_A_3(4PWL)
PPARG_HUMAN
[Raw transfer]




XDH_A_3(3OSI)
PPARG_HUMAN
[Raw transfer]




NRO_A_3(2ZK5)
PPARG_HUMAN
[Raw transfer]




SRO_A_4(3ADV)
PPARG_HUMAN
[Raw transfer]




KNA_A_4(3SZ1)
PPARG_HUMAN
[Raw transfer]




5HE_B_5(2VV2)
PPARG_HUMAN
[Raw transfer]




2 PsiBlast_PDB 91.3965%-120 - C3 -3E00 4.1 PPARG_HUMAN
1 PsiBlast_PDB 90.0965%-120 - C3 -3DZU - PPARG_HUMAN -
29 PsiBlast_CBE 85.6680%-135 - C3 -3DY6 7.4 PPARD_HUMAN
12 PsiBlast_PDB 85.5480%-137 - C3 -3DY6 7.4 PPARD_HUMAN
27 PsiBlast_CBE 85.2380%-133 - C3 -3PEQ 9.1 PPARD_HUMAN
13 PsiBlast_PDB 85.1980%-132 - C3 -3PEQ 9.5 PPARD_HUMAN
33 PsiBlast_CBE 85.1280%-128 - C3 -2ZNQ 9.2 PPARD_HUMAN
20 PsiBlast_PDB 85.0979%-131 - C3 -2B50 6.9 PPARD_HUMAN
38 PsiBlast_CBE 85.0580%-130 - C3 -3D5F 8.6 PPARD_HUMAN
31 PsiBlast_CBE 85.0279%-126 - C3 -3SP9 7.6 PPARD_HUMAN
14 PsiBlast_PDB 84.8580%-130 - C3 -3TKM 8.6 PPARD_HUMAN
19 PsiBlast_PDB 84.7480%-134 - C3 -2AWH 6.9 PPARD_HUMAN
15 PsiBlast_PDB 84.6679%-129 - C3 -3SP9 8.0 PPARD_HUMAN
36 PsiBlast_CBE 84.6479%-126 - C3 -2B50 7.2 PPARD_HUMAN
23 PsiBlast_CBE 84.5579%-127 - C3 -2XYJ 7.7 PPARD_HUMAN
40 PsiBlast_CBE 84.4881%-124 - C3 -3GZ9 - PPARD_HUMAN -
16 PsiBlast_PDB 84.1380%-126 - C3 -1Y0S 8.9 PPARD_HUMAN
7 PsiBlast_PDB 84.0979%-125 - C3 -3ET2 6.3 PPARD_HUMAN
35 PsiBlast_CBE 83.9780%-134 - C3 -2AWH 6.5 PPARD_HUMAN
18 PsiBlast_PDB 83.8480%-128 - C3 -2ZNQ 8.6 PPARD_HUMAN
37 PsiBlast_CBE 83.5480%-128 - C3 -3D5F 7.9 PPARD_HUMAN
25 PsiBlast_CBE 83.4879%-127 - C3 -3ET2 5.8 PPARD_HUMAN
3 PsiBlast_PDB 83.3879%-123 - C3 -2XYJ 7.7 PPARD_HUMAN
9 PsiBlast_PDB 83.3079%-133 - C3 -3OZ0 9.6 PPARD_HUMAN
32 PsiBlast_CBE 83.2780%-129 - C3 -1Y0S 8.9 PPARD_HUMAN
17 PsiBlast_PDB 83.2480%-127 - C3 -2ZNP 7.9 PPARD_HUMAN
39 PsiBlast_CBE 83.2280%-136 - C3 -2BAW 6.4 PPARD_HUMAN
5 PsiBlast_PDB 82.7979%-129 - C3 -2XYX 7.4 PPARD_HUMAN
34 PsiBlast_CBE 82.2980%-126 - C3 -2ZNP 9.4 PPARD_HUMAN
4 PsiBlast_PDB 82.1879%-128 - C3 -2XYW 9.5 PPARD_HUMAN
21 PsiBlast_CBE 82.1379%-123 - C3 -2XYX 7.6 PPARD_HUMAN
22 PsiBlast_CBE 81.9879%-128 - C3 -2XYW 9.7 PPARD_HUMAN
50 PsiBlast_CBE 81.9168%-132 - C3 -4CI4 6.8 PPARA_HUMAN
59 PsiBlast_CBE 81.1369%-130 - C3 -3FEI 7.4 PPARA_HUMAN
113 PsiBlast_CBE 80.9462%-127 - C3 -3SZ1 3.0 PPARG_HUMAN
104 PsiBlast_CBE 80.8962%-129 - C3 -2Q5S 6.1 PPARG_HUMAN
28 PsiBlast_CBE 80.7880%-122 - C3 -3GWX 5.8 PPARD_HUMAN
157 PsiBlast_CBE 80.7362%-125 - C3 -4CI5 6.6 PPARG_HUMAN
111 PsiBlast_CBE 80.7062%-125 - C3 -1ZEO 5.4 PPARG_HUMAN
213 PsiBlast_CBE 80.6562%-125 - C3 -2GTK 6.5 PPARG_HUMAN
49 PsiBlast_CBE 80.4167%-120 - C3 -3SP6 7.2 PPARA_HUMAN
149 PsiBlast_CBE 80.3562%-127 - C3 -3V9T 8.2 PPARG_HUMAN
223 PsiBlast_CBE 80.2562%-129 - C3 -4HEE 8.8 PPARG_HUMAN
151 PsiBlast_CBE 80.2262%-128 - C3 -3B1M 7.5 PPARG_HUMAN
246 HHSearch 80.0970%-122 - C3 -3VI8 7.9 PPARA_HUMAN
227 PsiBlast_CBE 80.0161%-125 - C3 -3ET3 6.1 PPARG_HUMAN
112 PsiBlast_CBE 79.9762%-123 - C3 -3SZ1 5.1 PPARG_HUMAN
181 PsiBlast_CBE 79.9562%-122 - C3 -3AN4 7.9 PPARG_HUMAN
173 PsiBlast_CBE 79.9262%-120 - C3 -3VSO 7.0 PPARG_HUMAN
193 PsiBlast_CBE 79.9062%-119 - C3 -2ZK2 4.0 PPARG_HUMAN
139 PsiBlast_CBE 79.8862%-126 - C3 -1I7I 4.0 PPARG_HUMAN
60 PsiBlast_CBE 79.8769%-121 - C3 -2P54 7.5 PPARA_HUMAN
158 PsiBlast_CBE 79.8662%-124 - C3 -3KMG 8.6 PPARG_HUMAN
105 PsiBlast_CBE 79.8362%-124 - C3 -2Q5P 7.2 PPARG_HUMAN
84 PsiBlast_CBE 79.8362%-122 - C3 -3ADW 3.1 PPARG_HUMAN
201 PsiBlast_CBE 79.7362%-127 - C3 -3OSI 6.4 PPARG_HUMAN
97 PsiBlast_CBE 79.7262%-123 - C3 -3PBA 6.1 PPARG_HUMAN
218 PsiBlast_CBE 79.7062%-123 - C3 -2F4B 7.1 PPARG_HUMAN
127 PsiBlast_CBE 79.6862%-121 - C3 -2VV3 5.5 PPARG_HUMAN
24 PsiBlast_CBE 79.6879%-134 - C3 -2Q5G 10.7 PPARD_HUMAN
212 PsiBlast_CBE 79.6762%-126 - C3 -2HWQ 5.5 PPARG_HUMAN
174 PsiBlast_CBE 79.6362%-123 - C3 -3VJH 5.2 PPARG_HUMAN
207 PsiBlast_CBE 79.6262%-127 - C3 -3G9E 6.1 PPARG_HUMAN
196 PsiBlast_CBE 79.5562%-120 - C3 -2I4Z 6.9 PPARG_HUMAN
114 PsiBlast_CBE 79.5162%-126 - C3 -3R5N 5.2 PPARG_HUMAN
200 PsiBlast_CBE 79.4562%-128 - C3 -3OSW 6.4 PPARG_HUMAN