@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1414: (2016-03-24 )
MKEVVIIDAVRTPIGKFGGSLKDISAVDLGATALKGVLERANIAPERVDQVIFGNVLQAGLGQNVARQIAIKAGIPYKVPGVTINEVCGSGLKSVMLGRQAIQLGEADIVAVGGTENMSQAPLLLNPELAGEEINPKKLRNSMLIDGLTDVYGEYHMGITAENVAEKFSVTREEQDEFAHNSQMKAASAQEKKLFEEEIIPVKLPDGSFFEADETIRANSTLEKLATLKSVFKEGGTVTAGNASGINDGASAIILMSKEKAVAENIPYIATIKVTSEVGVDPALMGYAPYYAVNEALTKGGYSIDEIDLFHLNEAFASQSVAVARDLKIPEEKLNIYGGAIALGHPIGASGARIIASLLNELKHENKHIGVASLCVGGGIGIAIILERA

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

COA_B_13(4UBV)
?
[Raw transfer]




COA_A_5(1WL4)
THIC_HUMAN
[Raw transfer]




COA_A_5(1WL4)
THIC_HUMAN
[Raw transfer]




GOL_Q_17(1WL5)
THIC_HUMAN
[Raw transfer]




DMS_A_14(4UBW)
?
[Raw transfer]




2 PsiBlast_PDB 95.6253% -77 - C4 -4N45 - ? -
4 PsiBlast_PDB 94.5551% -81 - C4 -4O99 - THIL_CUPNH -
1 PsiBlast_PDB 94.5253% -78 - C4 -4N44 - ? -
26 PsiBlast_CBE 94.4151% -80 - C4 -4O99 - THIL_CUPNH -
6 PsiBlast_PDB 94.1051% -80 - C4 -4O9A - THIL_CUPNH -
25 PsiBlast_CBE 93.8751% -80 - C4 -4O99 - THIL_CUPNH -
5 PsiBlast_PDB 92.9551% -81 - C4 -4O9C - THIL_CUPNH -
27 PsiBlast_CBE 92.8751% -80 - C4 -4O9C - THIL_CUPNH -
21 PsiBlast_CBE 92.8553% -79 - C4 -4N44 - ? -
28 PsiBlast_CBE 92.4851% -80 - C4 -4O9C - THIL_CUPNH -
3 PsiBlast_PDB 92.4552% -80 - C4 -4DD5 - THLA_PEPD6 -
125 HHSearch 91.5449% -78 - C4 -1WL4 6.8 THIC_HUMAN
7 PsiBlast_PDB 91.1548% -80 - C4 -1WL4 6.8 THIC_HUMAN
31 PsiBlast_CBE 90.9347% -81 - C4 -1DLV - THIL_ZOORA -
29 PsiBlast_CBE 90.8447% -81 - C4 -1DLV - THIL_ZOORA -
34 PsiBlast_CBE 90.6447% -81 - C4 -1DLU - THIL_ZOORA -
8 PsiBlast_PDB 90.6348% -79 - C4 -1WL5 2.4 THIC_HUMAN
47 PsiBlast_CBE 90.6047% -82 - C4 -2VTZ - THIL_ZOORA -
19 PsiBlast_PDB 90.3947% -82 - C4 -1M3Z - THIL_ZOORA -
9 PsiBlast_PDB 90.3947% -84 - C4 -1DLU - THIL_ZOORA -
93 PsiBlast_CBE 80.8833% -66 - C4 -4UBV 4.9 ?
92 PsiBlast_CBE 79.6933% -68 - C4 -4UBW 3.1 ?