@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1801: (2016-03-28 )
MAFEGLAGRLQETMNKIRGKGKVNEADVKEMMREVRLALLEADVNFKVVKQFIKTVSERAVGADVMKSLTPGQQVIKIVQEELTSLMGGEESKIGTADRPPTVIMMVGLQGAGKTTTSGKLANLLRKKYNRKPLLVAADIYRPAAIKQLETLGKQLDMPVFSLGDQVSPVEIAKQAIAKAKEEHLDYVIIDTAGRLHIDETLMDELKQVKEIATPTEILLVVDSMTGQDAVNVAQSFNEQLEITGVVLTKLDGDTRGGAALSIRSVTGKPIKFIATGEKMEALETFHPDRMASRILGMGDVLSLIEKAQTDVDTEKMKAMEQKMKDNSMTLDDFLEQLQQVKQMGPLDELLKMMPGANKMKGLDNMNVDDKQLGHIEAIIKSMTKNEKDNPDIINASRRKRIARGSGRPVQEINRLLKQFAEMKKMMKQMTGGGKGKKGKNPFGNFKMPF

Atome Classification :

(45 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GDP_B_17(3DM5)
SRP54_PYRFU
[Raw transfer]




GDP_B_17(3DM5)
SRP54_PYRFU
[Raw transfer]




GDP_A_6(1O87)
SRP54_THEAQ
[Raw transfer]




GDP_B_17(3DM5)
SRP54_PYRFU
[Raw transfer]




GCP_B_6(1RJ9)
SRP54_THEAQ
[Raw transfer]




GDP_B_11(4C7O)
FTSY_ECOLI
[Raw transfer]




GNP_B_20(2J7P)
SRP54_THEAQ
[Raw transfer]




GNP_A_12(2J7P)
SRP54_THEAQ
[Raw transfer]




GNP_A_6(1JPN)
SRP54_THEAQ
[Raw transfer]




GNP_B_5(1JPN)
SRP54_THEAQ
[Raw transfer]




GNP_B_2(1JPJ)
SRP54_THEAQ
[Raw transfer]




GDP_D_17(4C7O)
FTSY_ECOLI
[Raw transfer]




GDP_B_2(2NG1)
SRP54_THEAQ
[Raw transfer]




CIT_B_4(1VMA)
?
[Raw transfer]




GDP_B_12(1O87)
SRP54_THEAQ
[Raw transfer]




GDP_A_7(1NG1)
SRP54_THEAQ
[Raw transfer]




GDP_C_2(3E70)
?
[Raw transfer]




GCP_A_5(1RJ9)
SRP54_THEAQ
[Raw transfer]




GDP_C_2(3E70)
?
[Raw transfer]




GCP_D_17(1OKK)
SRP54_THEAQ
[Raw transfer]




GCP_D_17(1OKK)
FTSY_THEAQ
[Raw transfer]




GDP_B_11(4C7O)
SRP54_ECOLI
[Raw transfer]




GDP_D_17(4C7O)
SRP54_ECOLI
[Raw transfer]




GOL_B_14(3DMD)
?
[Raw transfer]




GNP_K_11(2Q9C)
FTSY_THEAQ
[Raw transfer]




FMT_B_11(1O87)
SRP54_THEAQ
[Raw transfer]




GNP_T_20(2Q9B)
FTSY_THEAQ
[Raw transfer]




EDO_B_13(3NG1)
SRP54_THEAQ
[Raw transfer]




GDP_D_2(2IYL)
FTSY_THEAQ
[Raw transfer]




GCP_B_6(1RJ9)
FTSY_THEAQ
[Raw transfer]




EDO_A_6(2J7P)
SRP54_THEAQ
[Raw transfer]




ACY_B_7(1JPN)
SRP54_THEAQ
[Raw transfer]




GDP_D_18(4C7O)
SRP54_ECOLI
[Raw transfer]




GCP_B_6(1RJ9)
FTSY_THEAQ
[Raw transfer]




EDO_B_14(3NG1)
SRP54_THEAQ
[Raw transfer]




GNP_B_20(2J7P)
FTSY_THEAQ
[Raw transfer]




EDO_A_2(2YHS)
FTSY_ECOLI
[Raw transfer]




ACY_A_9(1JPN)
SRP54_THEAQ
[Raw transfer]




EDO_A_12(3NG1)
SRP54_THEAQ
[Raw transfer]




EDO_A_2(2YHS)
FTSY_ECOLI
[Raw transfer]




GNP_A_12(2J7P)
FTSY_THEAQ
[Raw transfer]




1 PsiBlast_PDB 90.6554% -90 - C8 -2XXA - SRP54_ECOLI -
21 PsiBlast_CBE 90.2954% -91 - C8 -2XXA - SRP54_ECOLI -
78 HHSearch 88.3655% -72 - C- -2XXA - SRP54_ECOLI -
23 PsiBlast_CBE 85.5648% -84 - C8 -2FFH - SRP54_THEAQ -
79 HHSearch 85.4038% -82 - C8 -3DM5 Error SRP54_PYRFU
22 PsiBlast_CBE 85.1148% -82 - C8 -2FFH - SRP54_THEAQ -
5 PsiBlast_PDB 85.0738% -85 - C8 -3DM5 Error SRP54_PYRFU
2 PsiBlast_PDB 84.5748% -84 - C8 -2FFH - SRP54_THEAQ -
80 HHSearch 83.2247% -82 - C8 -2FFH - SRP54_THEAQ -
25 PsiBlast_CBE 82.7738% -87 - C8 -3DM5 6.9 SRP54_PYRFU
24 PsiBlast_CBE 81.2657% -97 - C8 -4C7O 4.0 SRP54_ECOLI
26 PsiBlast_CBE 80.1451%-101 - C8 -2J46 - SRP54_THEAQ -
4 PsiBlast_PDB 80.0357% -99 - C8 -4C7O 3.0 SRP54_ECOLI
28 PsiBlast_CBE 79.7551% -97 - C8 -2C04 - SRP54_THEAQ -
17 PsiBlast_PDB 79.3150% -94 - C8 -1OKK 2.9 SRP54_THEAQ
30 PsiBlast_CBE 79.1751%-101 - C8 -2C03 - SRP54_THEAQ -
27 PsiBlast_CBE 79.0751%-100 - C8 -2J45 - SRP54_THEAQ -
33 PsiBlast_CBE 79.0150% -95 - C8 -2J7P 9.2 SRP54_THEAQ
32 PsiBlast_CBE 78.9650% -96 - C8 -3NG1 3.7 SRP54_THEAQ
16 PsiBlast_PDB 78.9450% -96 - C8 -3NG1 3.7 SRP54_THEAQ
31 PsiBlast_CBE 78.7151% -99 - C8 -1JPN 6.2 SRP54_THEAQ
11 PsiBlast_PDB 78.6451% -95 - C8 -1JPN 6.8 SRP54_THEAQ
19 PsiBlast_PDB 78.5550% -94 - C8 -2J7P 9.2 SRP54_THEAQ
20 PsiBlast_PDB 77.8750% -92 - C8 -1NG1 7.1 SRP54_THEAQ
15 PsiBlast_PDB 77.7850% -92 - C8 -2NG1 5.4 SRP54_THEAQ
10 PsiBlast_PDB 77.6151% -95 - C8 -1JPJ 7.1 SRP54_THEAQ
7 PsiBlast_PDB 77.0651% -93 - C8 -1O87 7.0 SRP54_THEAQ
29 PsiBlast_CBE 76.9551% -91 - C8 -1O87 6.7 SRP54_THEAQ
6 PsiBlast_PDB 74.8751% -89 - C8 -1RJ9 9.1 SRP54_THEAQ
89 HHSearch 69.6734% -90 - C8 -3E70 7.0 ?
39 PsiBlast_CBE 67.5836% -93 - C8 -3DMD 3.7 ?
92 HHSearch 66.7834% -89 - C8 -2YHS 2.9 FTSY_ECOLI
98 HHSearch 66.6031% -98 - C8 -1RJ9 3.4 FTSY_THEAQ
37 PsiBlast_CBE 65.5636% -92 - C8 -3E70 7.0 ?
47 PsiBlast_CBE 63.3633% -80 - C8 -2YHS 2.9 FTSY_ECOLI
48 PsiBlast_CBE 61.0841% -85 - C8 -1VMA 3.9 ?
45 PsiBlast_CBE 59.7734% -72 - C8 -4C7O 6.9 FTSY_ECOLI
46 PsiBlast_CBE 59.3434% -68 - C8 -4C7O 6.4 FTSY_ECOLI
59 PsiBlast_CBE 56.8536% -75 - C8 -2J7P 2.9 FTSY_THEAQ
64 PsiBlast_CBE 56.0835% -67 - C8 -1RJ9 2.9 FTSY_THEAQ
58 PsiBlast_CBE 55.7336% -69 - C8 -2J7P 2.9 FTSY_THEAQ
51 PsiBlast_CBE 55.3936% -70 - C8 -1OKK 7.1 FTSY_THEAQ
53 PsiBlast_CBE 54.8136% -72 - C8 -2Q9C 6.2 FTSY_THEAQ
60 PsiBlast_CBE 54.7336% -82 - C8 -2IYL 4.8 FTSY_THEAQ
55 PsiBlast_CBE 54.3536% -76 - C8 -2Q9B 5.3 FTSY_THEAQ