@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2016: (2016-03-31 )
MQTGTVKWFNSEKGFGFIEVEGGDDVFVHFSAIEGEGFKTLDEGQSVEFEIVEGQRGPQAEKVTKL

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TRS_A_5(1C9O)
CSPB_BACCL
[Raw transfer]




NACID_U_3(3TS2)
LN28A_MOUSE
[Raw transfer]

-

TRS_A_7(1C9O)
CSPB_BACCL
[Raw transfer]




9 PsiBlast_PDB 91.6783% -92 - C6 -3PF5 - CSPB_BACSU -
10 PsiBlast_PDB 90.9383%-104 - C6 -2I5M - CSPB_BACSU -
21 PsiBlast_CBE 90.3083% -97 - C6 -3PF5 - CSPB_BACSU -
15 PsiBlast_PDB 90.1276%-103 - C6 -1HZC - CSPB_BACCL -
62 HHSearch 89.8077%-106 - C6 -1C9O 2.1 CSPB_BACCL
11 PsiBlast_PDB 89.8077%-106 - C6 -1C9O 2.6 CSPB_BACCL
8 PsiBlast_PDB 89.7083% -96 - C6 -3PF4 - CSPB_BACSU -
16 PsiBlast_PDB 89.6685%-115 - C6 -2I5L - CSPB_BACSU -
22 PsiBlast_CBE 89.5583% -94 - C6 -3PF4 - CSPB_BACSU -
14 PsiBlast_PDB 89.4877%-105 - C6 -1I5F - CSPB_BACCL -
4 PsiBlast_PDB 88.7783% -91 - C6 -1CSP - CSPB_BACSU -
24 PsiBlast_CBE 88.6377%-102 - C6 -1C9O - CSPB_BACCL -
5 PsiBlast_PDB 88.2383% -96 - C6 -1CSQ - CSPB_BACSU -
13 PsiBlast_PDB 87.9978% -99 - C6 -1HZA - CSPB_BACCL -
1 PsiBlast_PDB 87.6877% -98 - C6 -1HZ9 - CSPB_BACCL -
17 PsiBlast_PDB 87.1076%-103 - C6 -1HZB - CSPB_BACCL -
25 PsiBlast_CBE 86.6276%-101 - C6 -1HZB - CSPB_BACCL -
3 PsiBlast_PDB 86.0383%-105 - C6 -2F52 - CSPB_BACSU -
2 PsiBlast_PDB 85.6083%-107 - C6 -2ES2 - CSPB_BACSU -
7 PsiBlast_PDB 84.3383% -88 - C6 -1NMG - CSPB_BACSU -
77 HHSearch 76.8043% -98 * C6 *3TS2 11.9 LN28A_MOUSE