@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0595: (2015-12-02 )
MDILEIKNVNYSYANSKEKVLSGVNQKFELGKFYAIVGKSGTGKSTLLSLLAGLDKVQTGKILFKNEDIEKKGYSNHRKNNISLVFQNYNLIDYLSPIENIRLVNKSVDESILFELGLDKKQIKRNVMKLSGGQQQRVAIARALVSDAPIILADEPTGNLDSVTAGEIINILKELAQDRNKCVIVVTHSKEVADSADIILELSGKKLKKVNKMNLEVE

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_A_2(5DGX)
?
[Raw transfer]




IPA_A_6(3TIF)
Y796_METJA
[Raw transfer]




141 HHSearch 87.8037% -89 - C1 -3TIF 3.5 Y796_METJA
3 PsiBlast_PDB 85.0235% -96 - C1 -3TIF - Y796_METJA -
22 PsiBlast_CBE 84.6835%-100 - C1 -3TIF - Y796_METJA -
2 PsiBlast_PDB 84.6237% -98 - C1 -1F3O - Y796_METJA -
1 PsiBlast_PDB 83.8835% -98 - C1 -1L2T - Y796_METJA -
138 HHSearch 82.5634% -97 - C1 -2PCJ - LOLD_AQUAE -
21 PsiBlast_CBE 81.8035% -98 - C1 -1L2T - Y796_METJA -
123 HHSearch 80.0333% -84 - C1 -1OXX - ? -
94 PsiBlast_CBE 79.0231% -97 - C1 -1B0U - HISP_SALTY -
5 PsiBlast_PDB 78.7835%-107 - C1 -2PCL - LOLD_AQUAE -
142 HHSearch 78.4432% -95 - C1 -3NH6 - -
113 Fugue 77.1532% -78 - C1 -1OXS - ? -
4 PsiBlast_PDB 76.9035%-108 - C1 -2PCJ - LOLD_AQUAE -
131 HHSearch 75.5432% -92 - C1 -3RLF - MALK_ECOLI -
125 HHSearch 74.8335% -85 - C1 -2IT1 - ? -
122 HHSearch 74.5329% -92 - C1 -1Z47 - ? -
68 PsiBlast_CBE 74.4831% -83 - C1 -3RLF - MALK_ECOLI -
54 PsiBlast_CBE 74.2432% -94 - C1 -1OXV - ? -
76 PsiBlast_CBE 73.7531% -81 - C1 -3PUW - MALK_ECOLI -
77 PsiBlast_CBE 73.6531% -81 - C1 -3PUV - MALK_ECOLI -
90 PsiBlast_CBE 69.0232% -93 - C1 -5DGX 6.2 ?