@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0936: (2015-12-04 )
MLELKNISKCYGQKEIFKDFNLTVEEGKILSLVGPSGGGKTTLLRMLAGLEKIDSGTIVHDGKEVSVDHLETLNLLGFVFQDFQLFPHLTVLDNLILSPVKTMGLSKELAKAKALVLLERLGLKDHALVYPFSLSGGQKQRVALARAMMIDPQIIGYDEPTSALDPELRQEVEKLILQNRETGMTQIVVTHDLQFAESISDTILKINPK

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

LMT_A_7(4MKI)
ECFA2_CALS4
[Raw transfer]




ATP_A_3(3FVQ)
FBPC_NEIG1
[Raw transfer]




116 HHSearch 88.4345%-108 - C1 -2OLJ - ? -
31 PsiBlast_CBE 87.4144%-106 - C1 -4U02 - ? -
2 PsiBlast_PDB 86.8745%-110 - C1 -2OLJ - ? -
29 PsiBlast_CBE 86.8445%-105 - C1 -2OLK - ? -
33 PsiBlast_CBE 86.6644%-106 - C1 -4U02 - ? -
27 PsiBlast_CBE 86.2445%-106 - C1 -2OLK - ? -
14 PsiBlast_PDB 86.0938%-122 - C1 -1B0U - HISP_SALTY -
49 PsiBlast_CBE 85.8338%-112 - C1 -3PUW - MALK_ECOLI -
40 PsiBlast_CBE 85.8138%-108 - C1 -3RLF - MALK_ECOLI -
5 PsiBlast_PDB 85.6745%-102 - C1 -2Q0H - ? -
51 PsiBlast_CBE 85.4138%-110 - C1 -3PUV - MALK_ECOLI -
24 PsiBlast_CBE 85.4145%-104 - C1 -2OUK - ? -
32 PsiBlast_CBE 85.3944%-109 - C1 -4U02 - ? -
8 PsiBlast_PDB 85.3744%-106 - C1 -4U02 - ? -
45 PsiBlast_CBE 85.2838%-112 - C1 -3PUY - MALK_ECOLI -
34 PsiBlast_CBE 85.2741%-111 - C1 -4YMV - ? -
22 PsiBlast_CBE 84.8645%-111 - C1 -3C4J - ? -
7 PsiBlast_PDB 84.7144%-109 - C1 -4U00 - ? -
47 PsiBlast_CBE 84.7038%-111 - C1 -3PUX - MALK_ECOLI -
120 HHSearch 84.5940%-114 - C1 -1B0U - HISP_SALTY -
108 HHSearch 77.0137% -98 - C1 -3FVQ 7.0 FBPC_NEIG1
89 PsiBlast_CBE 63.2232% -93 - C1 -4MKI 2.1 ECFA2_CALS4