@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu00730: (2016-06-02 )
MVRVANSITELIGNTPIVKLNRLADENSADVYLKLEYMNPGSSVKDRIGLAMIEAAEKEGKLKAGNTIIEPTSGNTGIGLAMVAAAKGLKAILVMPDTMSMERRNLLRAYGAELVLTPGAEGMKGAIKKAEELAEKHGYFVPQQFNNPSNPEIHRQTTGKEIVEQFGDDQLDAFVAGIGTGGTITGAGEVLKEAYPSIKIYAVEPSDSPVLSGGKPGPHKIQGIGAGFVPDILNTEVYDEIFPVKNEEAFEYARRAAREEGILGGISSGAAIYAALQVAKKLGKGKKVLAIIPSNGERYLSTPLYQFD

Atome Classification :

(76 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

P1T_X_3(5DBH)
CYSK_HAEIN
[Raw transfer]




PUS_A_3(3X44)
DCSD_STRLA
[Raw transfer]




PDA_A_2(2Q3D)
CYSK_MYCTU
[Raw transfer]




PUS_A_3(3X44)
DCSD_STRLA
[Raw transfer]




PUS_B_4(3X44)
DCSD_STRLA
[Raw transfer]




P1T_A_3(3PC3)
?
[Raw transfer]




CIT_A_4(2V03)
CYSM_ECOLI
[Raw transfer]




ILE_A_3(4IL5)
?
[Raw transfer]




CYS_A_2(4LMB)
?
[Raw transfer]




AWH_A_3(3ZEI)
CYSK_MYCTU
[Raw transfer]




MET_B_4(4JBL)
?
[Raw transfer]




AA5_A_2(1Z7Y)
CYSK1_ARATH
[Raw transfer]




OAS_X_3(4ZU6)
CYSK_HAEIN
[Raw transfer]




CHAIN_C_2(4JBN)
?
[Raw transfer]

-

PLP_D_4(1D6S)
CYSK_SALTY
[Raw transfer]




PLP_E_5(1D6S)
CYSK_SALTY
[Raw transfer]




FGA_B_11(4AIR)
?
[Raw transfer]




PLP_B_10(3BM5)
?
[Raw transfer]




4AT_A_4(2EFY)
?
[Raw transfer]




PLP_A_3(1OAS)
CYSK_SALTY
[Raw transfer]




PLP_A_5(4LMA)
?
[Raw transfer]




PLP_A_4(4LMB)
?
[Raw transfer]




PLP_A_4(4LMB)
?
[Raw transfer]




PLP_A_3(1VE1)
?
[Raw transfer]




PLP_B_7(4LMA)
?
[Raw transfer]




PLP_B_6(2PQM)
?
[Raw transfer]




PLP_A_9(3BM5)
?
[Raw transfer]




4AT_B_6(2EFY)
?
[Raw transfer]




PLP_A_3(4AEC)
CYSKM_ARATH
[Raw transfer]




PLP_B_15(1FCJ)
CYSK_SALTY
[Raw transfer]




PLP_A_3(1Z7W)
CYSK1_ARATH
[Raw transfer]




PLP_A_5(2PQM)
?
[Raw transfer]




PLP_D_16(1FCJ)
CYSK_SALTY
[Raw transfer]




PLP_A_5(3VBE)
?
[Raw transfer]




PLP_A_5(2PQM)
?
[Raw transfer]




PLP_A_3(1OAS)
CYSK_SALTY
[Raw transfer]




PLP_A_13(1FCJ)
CYSK_SALTY
[Raw transfer]




PLP_B_4(1OAS)
CYSK_SALTY
[Raw transfer]




PLP_C_7(3VBE)
?
[Raw transfer]




PLP_B_6(3VBE)
?
[Raw transfer]




4MV_A_3(2ECO)
?
[Raw transfer]




PLP_C_14(1FCJ)
CYSK_SALTY
[Raw transfer]




PLP_X_4(4ZU6)
CYSK_HAEIN
[Raw transfer]




PLP_B_5(4L0D)
CBS_HUMAN
[Raw transfer]




PLP_A_3(4L0D)
CBS_HUMAN
[Raw transfer]




PLP_C_9(2BHS)
CYSM_ECOLI
[Raw transfer]




PLP_A_2(5D84)
SBNA_STAAE
[Raw transfer]




MPD_A_6(2Q3B)
CYSK_MYCTU
[Raw transfer]




PLP_A_7(2BHS)
CYSM_ECOLI
[Raw transfer]




MPD_A_6(2Q3B)
CYSK_MYCTU
[Raw transfer]




PLP_D_11(2BHS)
CYSM_ECOLI
[Raw transfer]




PLP_A_4(3DWG)
CYSM_MYCTU
[Raw transfer]




PLP_D_8(3VBE)
?
[Raw transfer]




PLP_B_8(2BHS)
CYSM_ECOLI
[Raw transfer]




PLP_B_5(2EFY)
?
[Raw transfer]




PLP_A_2(2ECQ)
?
[Raw transfer]




PLP_A_3(2EFY)
?
[Raw transfer]




PLP_A_3(1Z7W)
CYSK1_ARATH
[Raw transfer]




PLP_B_18(4COO)
CBS_HUMAN
[Raw transfer]




PLP_A_3(1VE1)
?
[Raw transfer]




PLP_B_5(4AEC)
CYSKM_ARATH
[Raw transfer]




PLP_A_3(4AEC)
CYSKM_ARATH
[Raw transfer]




PLP_A_5(4COO)
CBS_HUMAN
[Raw transfer]




PLP_A_2(2ECO)
?
[Raw transfer]




PLP_A_7(2ISQ)
CYSK1_ARATH
[Raw transfer]




FGA_B_10(4AIR)
?
[Raw transfer]




CYS_A_3(4LMB)
?
[Raw transfer]




3HL_A_3(2ECQ)
?
[Raw transfer]




CHAIN_P_3(1Y7L)
CYSK_HAEIN
[Raw transfer]

-

OAS_B_3(5HBG)
CYSM_HELPY
[Raw transfer]




FGA_B_9(4AIR)
?
[Raw transfer]




MPD_A_4(2Q3B)
CYSK_MYCTU
[Raw transfer]




CHAIN_B_2(3TBH)
?
[Raw transfer]

-

CHAIN_B_2(3TBH)
?
[Raw transfer]

-

CHAIN_B_3(2ISQ)
CYSK1_ARATH
[Raw transfer]

-

CHAIN_B_2(3T4P)
?
[Raw transfer]

-

101 HHSearch 91.4684% -96 - C2 -2EGU - ? -
1 PsiBlast_PDB 91.4383% -96 - C2 -2EGU - ? -
40 PsiBlast_CBE 86.1752% -72 - C2 -2EFY 3.6 ?
28 PsiBlast_CBE 85.8050% -71 - C2 -3X43 - DCSD_STRLA -
32 PsiBlast_CBE 85.7950% -74 - C2 -3X43 - DCSD_STRLA -
3 PsiBlast_PDB 85.5160% -61 - C2 -2Q3D 8.3 CYSK_MYCTU
15 PsiBlast_PDB 85.4550% -71 - C2 -3X43 - DCSD_STRLA -
41 PsiBlast_CBE 85.3552% -71 - C2 -2ECQ 4.0 ?
39 PsiBlast_CBE 85.2652% -70 - C2 -2EFY 3.3 ?
29 PsiBlast_CBE 85.2550% -74 - C2 -3X43 - DCSD_STRLA -
33 PsiBlast_CBE 85.0850% -72 - C2 -3X43 - DCSD_STRLA -
19 PsiBlast_PDB 85.0652% -70 - C2 -1VE1 3.7 ?
31 PsiBlast_CBE 84.6550% -70 - C2 -3X43 - DCSD_STRLA -
27 PsiBlast_CBE 84.6050% -71 - C2 -3X43 - DCSD_STRLA -
30 PsiBlast_CBE 84.3350% -71 - C2 -3X43 - DCSD_STRLA -
115 HHSearch 84.2757% -68 - C2 -1O58 - ? -
20 PsiBlast_PDB 84.1652% -71 - C2 -2ECO 4.3 ?
108 HHSearch 84.0458% -70 - C2 -1Z7W 4.5 CYSK1_ARATH
111 HHSearch 83.9851% -65 - C2 -1VE1 3.7 ?
110 HHSearch 83.8851% -67 - C2 -3TBH 4.8 ?
17 PsiBlast_PDB 83.7953% -67 - C2 -1OAS 3.9 CYSK_SALTY
11 PsiBlast_PDB 83.7857% -71 - C2 -1Z7W 4.5 CYSK1_ARATH
2 PsiBlast_PDB 83.6060% -67 - C2 -3ZEI 5.9 CYSK_MYCTU
12 PsiBlast_PDB 83.5557% -71 - C2 -2ISQ 8.2 CYSK1_ARATH
106 HHSearch 83.4859% -68 - C2 -2Q3B 3.0 CYSK_MYCTU
112 HHSearch 83.4156% -62 - C2 -4LMB 4.1 ?
123 Fugue 83.3253% -67 - C2 -1OAS 3.9 CYSK_SALTY
13 PsiBlast_PDB 83.2857% -68 - C2 -1Z7Y 3.6 CYSK1_ARATH
42 PsiBlast_CBE 83.1952% -61 - C2 -1D6S 4.9 CYSK_SALTY
8 PsiBlast_PDB 83.1856% -65 - C2 -4LMA 4.2 ?
4 PsiBlast_PDB 83.1860% -64 - C2 -2Q3B 3.0 CYSK_MYCTU
16 PsiBlast_PDB 83.1149% -65 - C2 -3X44 7.3 DCSD_STRLA
43 PsiBlast_CBE 83.0752% -59 - C2 -1D6S 5.1 CYSK_SALTY
102 HHSearch 82.9849% -65 - C2 -3X44 7.3 DCSD_STRLA
35 PsiBlast_CBE 82.8653% -68 - C2 -1OAS 3.7 CYSK_SALTY
107 HHSearch 82.8554% -68 * C2 *4AEC 3.9 CYSKM_ARATH
61 PsiBlast_CBE 82.7347% -71 - C2 -2PQM 4.0 ?
51 PsiBlast_CBE 82.5649% -67 - C2 -3VBE 4.4 ?
9 PsiBlast_PDB 82.4656% -57 - C2 -4LMB 4.1 ?
45 PsiBlast_CBE 82.4250% -62 - C2 -3TBH 4.8 ?
34 PsiBlast_CBE 82.3849% -65 - C2 -3X44 7.2 DCSD_STRLA
60 PsiBlast_CBE 82.2047% -73 - C2 -2PQM 3.7 ?
62 PsiBlast_CBE 82.1746% -73 - C2 -4JBN 3.1 ?
64 PsiBlast_CBE 82.1546% -71 - C2 -4IL5 3.3 ?
26 PsiBlast_CBE 81.9853% -58 - C2 -4AEC 4.0 CYSKM_ARATH
114 HHSearch 81.9649% -73 - C2 -2PQM 3.9 ?
22 PsiBlast_CBE 81.9256% -63 - C2 -4LMA 4.4 ?
46 PsiBlast_CBE 81.7850% -64 - C2 -3T4P 6.7 ?
49 PsiBlast_CBE 81.7249% -64 - C2 -3VBE 3.8 ?
48 PsiBlast_CBE 81.5549% -66 - C2 -3VBE 4.5 ?
69 PsiBlast_CBE 81.4550% -58 - C2 -5DBH 7.8 CYSK_HAEIN
36 PsiBlast_CBE 81.3953% -64 - C2 -1FCJ 3.9 CYSK_SALTY
38 PsiBlast_CBE 81.3653% -63 - C2 -1FCJ 4.0 CYSK_SALTY
50 PsiBlast_CBE 81.3149% -65 - C2 -3VBE 4.4 ?
59 PsiBlast_CBE 81.2747% -69 - C2 -3BM5 3.8 ?
14 PsiBlast_PDB 81.2053% -59 - C2 -4AEC 3.8 CYSKM_ARATH
18 PsiBlast_PDB 81.0353% -63 - C2 -1FCJ 3.8 CYSK_SALTY
116 HHSearch 80.6649% -70 - C2 -1Y7L 5.5 CYSK_HAEIN
37 PsiBlast_CBE 80.2953% -60 - C2 -1FCJ 3.6 CYSK_SALTY
58 PsiBlast_CBE 79.8547% -64 - C2 -3BM5 3.3 ?
65 PsiBlast_CBE 79.7446% -62 - C2 -4JBL 3.9 ?
124 Fugue 79.2740% -52 - C2 -3PC3 8.5 ?
88 PsiBlast_CBE 78.6540% -56 - C2 -4L0D 3.5 CBS_HUMAN
89 PsiBlast_CBE 78.3840% -55 - C2 -4L0D 4.0 CBS_HUMAN
83 PsiBlast_CBE 77.9940% -54 - C2 -4COO 4.8 CBS_HUMAN
84 PsiBlast_CBE 77.1740% -53 - C2 -4COO 4.7 CBS_HUMAN
44 PsiBlast_CBE 77.0850% -67 - C2 -4AIR 3.3 ?
118 HHSearch 76.6239% -58 - C2 -3DWG 3.8 CYSM_MYCTU
119 HHSearch 75.8245% -67 - C2 -2V03 3.2 CYSM_ECOLI
72 PsiBlast_CBE 75.1643% -64 - C2 -2BHS 3.7 CYSM_ECOLI
71 PsiBlast_CBE 74.7443% -63 - C2 -2BHS 3.7 CYSM_ECOLI
70 PsiBlast_CBE 74.6143% -62 - C2 -2BHS 3.6 CYSM_ECOLI
73 PsiBlast_CBE 74.5343% -61 - C2 -2BHS 3.6 CYSM_ECOLI
113 HHSearch 72.9234% -65 - C2 -5D84 3.8 SBNA_STAAE
67 PsiBlast_CBE 50.8945% 6 - C2 -5HBG 1.5 CYSM_HELPY
68 PsiBlast_CBE 50.0050% 18 - C2 -4ZU6 3.8 CYSK_HAEIN