@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu01950: (2016-06-03 )
MQLMQVQNLSKCYRNGDGVEHLSFSIQRGEIVALLGPNGAGKTTTIRCLTGLYKPDKGDILIEGSPPGDINVQKKVALIPDQPYLYPALTAAEHIQFRARGYHPGKKDVKERVYHALKEVHLEEKANQLCGQLSRGQKQRVVLAGAIVQDALLYILDEPTVGLDIPSKQWLSNWLKTKTDQGCSAFVSTHSLEFVIETADRVILIRDGKLMQDLYVPQFEEQAEWRKEVIRLLGEWSDE

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_B_6(1L2T)
Y796_METJA
[Raw transfer]




ADP_B_8(3TIF)
Y796_METJA
[Raw transfer]




ADP_A_3(4YER)
?
[Raw transfer]




13 PsiBlast_PDB 89.9431% -88 - C1 -1OXV - ? -
27 PsiBlast_CBE 88.4131% -92 - C1 -1OXU - ? -
26 PsiBlast_CBE 87.5731% -93 - C1 -1OXU - ? -
10 PsiBlast_PDB 87.4131% -92 - C1 -1OXS - ? -
25 PsiBlast_CBE 87.1531% -92 - C1 -1OXV - ? -
51 Fugue 86.9231% -99 - C1 -1Z47 - ? -
24 PsiBlast_CBE 86.8831% -90 - C1 -1OXV - ? -
11 PsiBlast_PDB 86.4631% -91 - C1 -1OXT - ? -
12 PsiBlast_PDB 85.9731% -91 - C1 -1OXU - ? -
50 Fugue 84.0932% -84 - C1 -1OXS - ? -
46 HHSearch 84.0134% -90 - C1 -4MKI - ECFA2_CALS4 -
21 PsiBlast_CBE 80.6233%-103 - C1 -1Z47 - ? -
16 PsiBlast_PDB 79.8332% -96 - C1 -1OXX - ? -
20 PsiBlast_PDB 78.3628% -99 - C1 -3GFO - ECFA3_CLOP1 -
44 HHSearch 75.8832% -97 - C1 -4RVC - ? -
2 PsiBlast_PDB 75.7233% -99 - C1 -1Z47 - ? -
15 PsiBlast_PDB 75.5633% -93 - C1 -4MKI - ECFA2_CALS4 -
7 PsiBlast_PDB 74.0632%-100 - C1 -4YMW - ? -
8 PsiBlast_PDB 73.9630% -95 - C1 -1VPL - ? -
38 HHSearch 73.4031% -86 - C1 -1OXX - ? -
29 HHSearch 35.8031% -16 - C1 -4YER 5.7 ?