@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu10880: (2016-06-17 )
MTLSQWQPSRKSDVPLHRQIEQYMKDKILHGEWAVGTKIPSQRTLADMFQVNRSTVTAAIDELTSQGLLEGRKGGGTKVVNSTWSVLTAEPPLDWSDYVRSGIHRANSSIIQAINQNEPRADIIRLGTGELSPDLVPADTIGRMFQQINPGVLSLGYEQPKGNRQLREAVADHLKGKKIHVSPSAILIVSGALQALQLISIGLLKRDSVILTEKPSYLQSLHVFQSAGMRLRGLPMDDEGVKAGLVSSNRKQYGGQLLYTIPSFHNPTGTVMSEQRRKEIISLSKKEQMPIIEDDAYGDLWFEEKPPQPLKAMDHEGNILYLGAFSKTVSPGLRIGWLAGPEPVIERLADIKMQTDYGSSGLSQWAAAEWLSQGYYEEHLTWVRRKLKERRDAAVHFLERYAGDIATWRIPAGGFYIWVTFHKNLPVSRFFYELLKRQVLVNPGYIYDGEDRNSIRLSYSYASLGDLETGIKAAAETARRLMMS

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGU_A_3(2ZYJ)
LYSN_THET2
[Raw transfer]




N5F_A_3(3CBF)
LYSN_THET2
[Raw transfer]




PMP_C_6(3AV7)
?
[Raw transfer]




PGU_A_3(2ZYJ)
LYSN_THET2
[Raw transfer]




PMP_A_3(3AV7)
?
[Raw transfer]




PMP_C_8(3WX9)
?
[Raw transfer]




PMP_A_3(3WX9)
?
[Raw transfer]




PLP_C_5(3AOW)
?
[Raw transfer]




PLP_A_3(3AOW)
?
[Raw transfer]




PLP_C_6(3ATH)
?
[Raw transfer]




PLP_C_4(3AOV)
?
[Raw transfer]




LEU_A_3(2Z1Y)
LYSN_THET2
[Raw transfer]




AKG_C_6(3AOW)
?
[Raw transfer]




59 HHSearch 75.9933% -92 * C2 *3AOW 4.0 ?
21 PsiBlast_CBE 75.9933%-100 - C2 -3WX9 6.1 ?
4 PsiBlast_PDB 75.9233%-102 - C2 -3AV7 5.1 ?
8 PsiBlast_PDB 75.3428% -97 - C2 -1WST - ? -
22 PsiBlast_CBE 75.0633% -99 - C2 -3AV7 4.9 ?
25 PsiBlast_CBE 74.8133%-100 - C2 -3AOV 4.8 ?
1 PsiBlast_PDB 74.6433%-100 - C2 -3AOV - ? -
6 PsiBlast_PDB 74.6333%-103 - C2 -1X0M - ? -
3 PsiBlast_PDB 74.5333% -99 - C2 -3ATH - ? -
2 PsiBlast_PDB 74.2633% -99 - C2 -3AOW - ? -
5 PsiBlast_PDB 74.0533%-100 - C2 -3WX9 4.7 ?
23 PsiBlast_CBE 74.0033%-100 - C2 -3ATH 3.8 ?
24 PsiBlast_CBE 73.7833% -97 - C2 -3AOW 3.7 ?
62 HHSearch 73.7031% -97 - C2 -2ZC0 - ? -
7 PsiBlast_PDB 73.4232%-100 - C2 -2ZC0 - ? -
27 PsiBlast_CBE 73.3932%-102 - C2 -2ZC0 - ? -
65 HHSearch 72.7530% -96 - C2 -2ZYJ 8.7 LYSN_THET2
26 PsiBlast_CBE 72.2132%-101 - C2 -2ZC0 - ? -
28 PsiBlast_CBE 71.7732%-103 - C2 -2ZC0 - ? -
13 PsiBlast_PDB 71.5529% -91 - C2 -2ZYJ 9.3 LYSN_THET2