@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu11650: (2016-06-18 )
MKFSEECRSAAAEWWEGSFVHPFVQGIGDGTLPIDRFKYYVLQDSYYLTHFAKVQSFGAAYAKDLYTTGRMASHAQGTYEAEMALHREFAELLEISEEERKAFKPSPTAYSYTSHMYRSVLSGNFAEILAALLPCYWLYYEVGEKLLHCDPGHPIYQKWIGTYGGDWFRQQVEEQINRFDELAENSTEEVRAKMKENFVISSYYEYQFWGMAYRKEGWSDSAIKEVEECGASRHNG

Atome Classification :

(24 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PF1_B_4(2QCX)
TENA_BACSU
[Raw transfer]




PF1_A_3(2QCX)
TENA_BACSU
[Raw transfer]




PF1_A_3(2QCX)
TENA_BACSU
[Raw transfer]




HMH_K_11(1YAK)
TENA_BACSU
[Raw transfer]




HMH_M_13(1YAK)
TENA_BACSU
[Raw transfer]




HMH_O_15(1YAK)
TENA_BACSU
[Raw transfer]




HMH_I_9(1YAK)
TENA_BACSU
[Raw transfer]




HMH_D_8(2GM8)
?
[Raw transfer]




HMH_B_6(2GM8)
?
[Raw transfer]




HMH_C_7(2GM8)
?
[Raw transfer]




HMH_A_5(2GM8)
?
[Raw transfer]




HMH_A_5(2GM8)
?
[Raw transfer]




HMH_A_3(1TO9)
TENA_BACSU
[Raw transfer]




IMD_A_3(2QZC)
?
[Raw transfer]




IMD_A_2(3MVU)
?
[Raw transfer]




EDO_A_13(3MVU)
?
[Raw transfer]




PE4_A_6(2GM7)
?
[Raw transfer]




PE4_D_8(2GM7)
?
[Raw transfer]




PE4_C_7(2GM7)
?
[Raw transfer]




23 PsiBlast_CBE 82.31100%-106 - C4 -1YAK 3.3 TENA_BACSU
5 PsiBlast_PDB 82.3197%-103 - C4 -1TO9 3.2 TENA_BACSU
22 PsiBlast_CBE 81.83100%-107 - C4 -1YAK 3.4 TENA_BACSU
31 HHSearch 81.48100%-101 - C4 -2QCX 4.4 TENA_BACSU
24 PsiBlast_CBE 81.2999%-100 - C4 -2QCX 4.5 TENA_BACSU
3 PsiBlast_PDB 81.2899%-101 - C4 -2QCX 4.4 TENA_BACSU
1 PsiBlast_PDB 80.49100%-104 - C4 -1YAF - TENA_BACSU -
21 PsiBlast_CBE 79.90100% -99 - C4 -1YAK 3.5 TENA_BACSU
4 PsiBlast_PDB 79.8197%-103 - C4 -1TYH - TENA_BACSU -
2 PsiBlast_PDB 78.73100% -99 - C4 -1YAK 3.4 TENA_BACSU
33 HHSearch 78.7235%-147 - C4 -3IBX - TENA_HELPX -
6 PsiBlast_PDB 78.0034%-147 - C4 -3IBX - TENA_HELPX -
7 PsiBlast_PDB 71.9134%-134 - C4 -2RD3 - TENA_HELPX -
28 PsiBlast_CBE 65.9433%-124 - C4 -2GM7 4.5 ?
10 PsiBlast_PDB 65.6626%-133 - C4 -1UDD - ? -
8 PsiBlast_PDB 65.0833%-126 - C4 -2GM7 4.1 ?
34 HHSearch 64.9527%-122 - C4 -3MVU 4.0 ?
52 Fugue 64.8426%-129 - C4 -1UDD - ? -
29 PsiBlast_CBE 64.3433%-122 - C4 -2GM7 3.9 ?
9 PsiBlast_PDB 63.8533%-120 - C4 -2GM8 2.7 ?
27 PsiBlast_CBE 63.3733%-121 - C4 -2GM8 3.6 ?
41 HHSearch 62.1631%-123 * C4 *2GM8 2.7 ?
25 PsiBlast_CBE 61.8733%-119 - C4 -2GM8 3.0 ?
26 PsiBlast_CBE 61.4833%-119 - C4 -2GM8 3.1 ?