@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu14830: (2016-06-23 )
MVCQHNDELEALVKKAKKVTDKGEVASYIPALAKADKHDLSVAIYYSNNVCLSAGDVEKTFTLQSISKVLSLALVLMEYGKDKVFSYVGQEPTGDPFNSIIKLETVNPSKPLNPMINAGALVVTSLIRGRTVKERLDYLLSFIRRLTNNQEITYCREVAESEYSTSMINRAMCYYMKQYGIFEDDVEAVMDLYTKQCAIEMNSLDLAKIGSVFALNGRHPETGEQVISKDVARICKTFMVTCGMYNASGEFAIKVGIPAKSGVSGGIMGISPYDFGIGIFGPALDEKGNSIAGVKLLEIMSEMYRLSIF

Atome Classification :

(27 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GLN_A_2(3VP0)
GLSK_HUMAN
[Raw transfer]




GLU_A_3(3CZD)
GLSK_HUMAN
[Raw transfer]




GLU_B_4(3IHA)
?
[Raw transfer]




GLU_B_4(3AGE)
?
[Raw transfer]




GLU_A_3(3VP1)
GLSK_HUMAN
[Raw transfer]




GLU_A_3(3AGE)
?
[Raw transfer]




GLU_A_3(3IHA)
?
[Raw transfer]




ONL_A_2(4O7D)
GLSK_HUMAN
[Raw transfer]




DON_A_4(2OSU)
GLSA1_BACSU
[Raw transfer]




GLU_A_3(3IHB)
?
[Raw transfer]




ONL_A_3(3BRM)
GLSA1_BACSU
[Raw transfer]




GLU_B_4(3IHB)
?
[Raw transfer]




EDO_B_12(1U60)
GLSA1_ECOLI
[Raw transfer]




EDO_A_8(1U60)
GLSA1_ECOLI
[Raw transfer]




EDO_D_15(1U60)
GLSA1_ECOLI
[Raw transfer]




EDO_A_8(1U60)
GLSA1_ECOLI
[Raw transfer]




EDO_D_16(1U60)
GLSA1_ECOLI
[Raw transfer]




1 PsiBlast_PDB 90.6060%-125 - C6 -2PBY - GLSA_GEOKA -
54 HHSearch 90.1961%-124 - C6 -2PBY - GLSA_GEOKA -
77 Fugue 81.9535%-118 - C6 -3UO9 - GLSK_HUMAN -
57 HHSearch 80.8046%-106 - C6 -1MKI - GLSA1_BACSU -
59 HHSearch 80.1135%-116 * C6 *3UO9 - GLSK_HUMAN -
3 PsiBlast_PDB 79.3542%-115 - C6 -2OSU 3.2 GLSA1_BACSU
76 Fugue 78.9239%-106 - C6 -3IF5 - ? -
58 HHSearch 77.8538%-109 - C6 -3AGD - ? -
5 PsiBlast_PDB 77.5742%-104 - C6 -1MKI - GLSA1_BACSU -
13 PsiBlast_PDB 76.9939%-105 - C6 -3AGE 4.5 ?
2 PsiBlast_PDB 76.7844%-105 - C6 -3AGF - GLSA1_BACSU -
4 PsiBlast_PDB 76.1242%-111 - C6 -3BRM 3.5 GLSA1_BACSU
26 PsiBlast_CBE 76.0839% -99 - C6 -3AGE 3.4 ?
12 PsiBlast_PDB 75.9239%-105 - C6 -3AGD - ? -
7 PsiBlast_PDB 75.1339% 0 - C- -3IF5 - ? -
29 PsiBlast_CBE 74.7336%-109 - C6 -3VP1 3.8 GLSK_HUMAN
11 PsiBlast_PDB 74.5739%-103 - C6 -3IHB 3.2 ?
10 PsiBlast_PDB 74.5439%-102 - C6 -3IHA 3.5 ?
15 PsiBlast_PDB 74.5137%-104 - C6 -4O7D 2.9 GLSK_HUMAN
24 PsiBlast_CBE 74.3539%-103 - C6 -3IHB 3.6 ?
25 PsiBlast_CBE 73.7739%-101 - C6 -3IHA 3.5 ?
20 PsiBlast_PDB 73.4936%-107 - C6 -3VP0 2.6 GLSK_HUMAN
17 PsiBlast_PDB 73.2736%-107 - C6 -3CZD 3.6 GLSK_HUMAN
55 HHSearch 69.7935% -94 - C6 -1U60 2.9 GLSA1_ECOLI
23 PsiBlast_CBE 69.7438% -93 - C6 -1U60 3.4 GLSA1_ECOLI
6 PsiBlast_PDB 69.5938% -95 - C6 -1U60 2.9 GLSA1_ECOLI
21 PsiBlast_CBE 69.2438% -94 - C6 -1U60 3.1 GLSA1_ECOLI