@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu16870: (2016-06-26 )
MNKTALITGASGGIGKSISETLAARGYNLLLHYNTNQNAAAELAEKLSQMFGVNAEILQADLSAQDGADKLTSSIVQPIDAIVLNSGRSHFGLITDVDNATVQEMVQLHVASPYMLTRNLLPGMIRNKSGAIVAVSSIWGETGASCEVLYSMAKGAQHSFVKGLAKELAPSGIRVNAVAPGAVDTNMMNQFTPAEKEEIADEIPIGRLARPQEIADATAFLLSEKASYITGQILSVNGGWHC

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_B_22(3RRO)
FABG_VIBCH
[Raw transfer]




EDO_A_10(3RRO)
FABG_VIBCH
[Raw transfer]




EDO_A_11(3RRO)
FABG_VIBCH
[Raw transfer]




1 PsiBlast_PDB 81.5436% -98 - C1 -2PNF - FABG_AQUAE -
21 PsiBlast_CBE 80.4536%-102 - C1 -2PNF - FABG_AQUAE -
2 PsiBlast_PDB 80.4236% -97 - C1 -2P68 - FABG_AQUAE -
107 HHSearch 78.6733%-145 - C1 -1O5I - ? -
76 PsiBlast_CBE 78.5832%-129 - C1 -4BO2 - FABG_PSEAE -
75 PsiBlast_CBE 78.4132%-122 - C1 -4BO2 - FABG_PSEAE -
89 PsiBlast_CBE 78.2832%-125 - C1 -4BNY - FABG_PSEAE -
92 PsiBlast_CBE 78.1132%-129 - C1 -4BNX - FABG_PSEAE -
96 PsiBlast_CBE 78.0532%-121 - C1 -4BNW - FABG_PSEAE -
22 PsiBlast_CBE 77.9333% -96 - C1 -3SJ7 - ? -
8 PsiBlast_PDB 77.1435%-109 - C1 -2PH3 - ? -
82 PsiBlast_CBE 76.5332%-129 - C1 -4BO0 - FABG_PSEAE -
24 PsiBlast_CBE 76.5033%-108 - C1 -1Q7B - FABG_ECOLI -
60 PsiBlast_CBE 76.3232%-126 - C1 -4BO7 - FABG_PSEAE -
95 PsiBlast_CBE 76.2832%-125 - C1 -4BNX - FABG_PSEAE -
67 PsiBlast_CBE 76.1732%-120 - C1 -4BO4 - FABG_PSEAE -
66 PsiBlast_CBE 76.1632%-124 - C1 -4BO5 - FABG_PSEAE -
80 PsiBlast_CBE 76.0332%-124 - C1 -4BO0 - FABG_PSEAE -
85 PsiBlast_CBE 76.0232%-124 - C1 -4BNZ - FABG_PSEAE -
88 PsiBlast_CBE 75.5832%-120 - C1 -4BNY - FABG_PSEAE -
39 PsiBlast_CBE 70.0832%-108 - C1 -3RRO 2.6 FABG_VIBCH
12 PsiBlast_PDB 69.5832%-107 - C1 -3RRO 3.0 FABG_VIBCH