@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu22490: (2016-07-04 )
MSNETIKLVIAGPRGRMGQEAVKLAERTPHFDLVGAIDHTYDQQKLSDVMPVESDAFIYTDIHACFTETQPDVLIDLTTPEIGKVHTKIALEHGVRPVVGTTGFSEADLKELTSLTEEKGIGAIIAPNFALGAILMMKFSKMAANYFEDVEIIELHHDQKLDAPSGTALKTAEMISEVRKEKQQGHPDEKEILPGARGAEQNGIRLHSVRLPGLIAHQEVMFGMDGQTLQIRHDSYNRASFMSGVKLSVEQVMKIDQLVYGLENIID

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAD_E_5(1P9L)
DAPB_MYCTU
[Raw transfer]




NDP_G_7(1C3V)
DAPB_MYCTU
[Raw transfer]




NAD_I_9(1P9L)
DAPB_MYCTU
[Raw transfer]




NDP_E_5(1C3V)
DAPB_MYCTU
[Raw transfer]




NAD_E_5(1P9L)
DAPB_MYCTU
[Raw transfer]




NAP_A_3(5EES)
DAPB_CORGL
[Raw transfer]




NAP_A_3(5EES)
DAPB_CORGL
[Raw transfer]




PGE_A_4(4YWJ)
DAPB_PSEAE
[Raw transfer]




3 PsiBlast_PDB 94.9940% -88 - C2 -5EES 9.4 DAPB_CORGL
2 PsiBlast_PDB 94.0940% -90 - C2 -5EER - DAPB_CORGL -
45 HHSearch 89.7740% -67 - C2 -5EES 10.0 DAPB_CORGL
46 HHSearch 87.9538% -63 - C2 -1P9L 8.7 DAPB_MYCTU
48 HHSearch 84.0031% -32 - C2 -4F3Y - DAPB_BURTA -
23 PsiBlast_CBE 83.7745% -56 - C2 -1C3V 5.2 DAPB_MYCTU
22 PsiBlast_CBE 83.6845% -57 - C2 -1P9L 5.8 DAPB_MYCTU
5 PsiBlast_PDB 83.5145% -55 - C2 -1P9L 5.0 DAPB_MYCTU
4 PsiBlast_PDB 82.5945% -57 - C2 -1C3V 5.2 DAPB_MYCTU
28 PsiBlast_CBE 82.5345% -52 - C2 -1YL7 - DAPB_MYCTU -
27 PsiBlast_CBE 82.1045% -55 - C2 -1YL7 - DAPB_MYCTU -
7 PsiBlast_PDB 82.0045% -55 - C2 -1YL7 - DAPB_MYCTU -
25 PsiBlast_CBE 81.8845% -52 - C2 -1YL7 - DAPB_MYCTU -
6 PsiBlast_PDB 81.7945% -52 - C2 -1YL6 - DAPB_MYCTU -
24 PsiBlast_CBE 81.6745% -51 - C2 -1YL7 - DAPB_MYCTU -
29 PsiBlast_CBE 81.5745% -56 - C2 -1YL7 - DAPB_MYCTU -
1 PsiBlast_PDB 81.5745% -46 - C2 -1YL5 - DAPB_MYCTU -
30 PsiBlast_CBE 80.9145% -54 - C2 -1YL7 - DAPB_MYCTU -
26 PsiBlast_CBE 80.6845% -50 - C2 -1YL7 - DAPB_MYCTU -
12 PsiBlast_PDB 77.9127% -29 - C2 -1DRV - DAPB_ECOLI -