@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu27990: (2016-07-14 )
MGEAIVITSGKGGVGKTTTSANLGTALAILGKRVCLVDTDIGLRNLDVVMGLENRIIYDLVDVVEGRCKMHQALVKDKRFDDLLYLMPAAQTSDKTAVAPEQIKNMVQELKQEFDYVIIDCPAGIEQGYKNAVSGADKAIVVTTPEISAVRDADRIIGLLEQEENIEPPRLVVNRIRNHLMKNGDTMDIDEIVQHLSIDLLGIVADDDEVIKASNHGEPIAMDPKNRASIAYRNIARRILGESVPLQVLEEQNKGMMAKIKSFFGVRS

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_B_4(4RZ3)
?
[Raw transfer]




ATP_B_6(3Q9L)
MIND_ECOLI
[Raw transfer]




ATP_A_4(3Q9L)
MIND_ECOLI
[Raw transfer]




ATP_B_6(3Q9L)
MIND_ECOLI
[Raw transfer]




ATP_B_6(3Q9L)
MIND_ECOLI
[Raw transfer]




ADP_B_4(4RZ3)
?
[Raw transfer]




ADP_A_3(4V03)
?
[Raw transfer]




ADP_A_3(4V03)
?
[Raw transfer]




ADP_B_10(3R9I)
MIND_ECOLI
[Raw transfer]




ADP_C_11(3R9I)
MIND_ECOLI
[Raw transfer]




ATP_B_8(4V02)
?
[Raw transfer]




ATP_A_6(4V02)
?
[Raw transfer]




ADP_B_6(3R9J)
MIND_ECOLI
[Raw transfer]




ACP_A_3(1G3R)
?
[Raw transfer]




ADP_B_5(4V03)
?
[Raw transfer]




ADP_A_3(1G3Q)
?
[Raw transfer]




ADP_B_6(3R9J)
MIND_ECOLI
[Raw transfer]




ATP_B_6(3Q9L)
MIND_ECOLI
[Raw transfer]




ADP_B_10(3R9I)
MIND_ECOLI
[Raw transfer]




ADP_D_12(3R9I)
MIND_ECOLI
[Raw transfer]




ADP_D_12(3R9I)
MIND_ECOLI
[Raw transfer]




5 PsiBlast_PDB 82.0843% -39 - C2 -3R9J 2.9 MIND_ECOLI
4 PsiBlast_PDB 81.8943% -33 - C2 -3R9I 2.7 MIND_ECOLI
23 PsiBlast_CBE 81.8743% -41 - C2 -3R9J 7.2 MIND_ECOLI
163 Fugue 81.3943% -31 - C2 -3Q9L 2.2 MIND_ECOLI
24 PsiBlast_CBE 81.3243% -32 - C2 -3R9I 7.5 MIND_ECOLI
142 HHSearch 81.2344% -33 * C2 *3Q9L 2.2 MIND_ECOLI
26 PsiBlast_CBE 80.6943% -36 - C2 -3R9I 7.5 MIND_ECOLI
25 PsiBlast_CBE 80.6543% -37 - C2 -3R9I 2.7 MIND_ECOLI
27 PsiBlast_CBE 80.6343% -28 - C2 -3Q9L 7.9 MIND_ECOLI
3 PsiBlast_PDB 80.5643% -28 - C2 -3Q9L 2.2 MIND_ECOLI
2 PsiBlast_PDB 78.3650% -25 - C2 -4V02 8.0 ?
1 PsiBlast_PDB 76.1050% -20 - C2 -4V03 10.1 ?
22 PsiBlast_CBE 76.0250% -24 - C2 -4V02 8.3 ?
21 PsiBlast_CBE 75.6950% -22 - C2 -4V03 9.6 ?
139 HHSearch 74.8751% -19 - C2 -4V03 10.1 ?
9 PsiBlast_PDB 66.9931% 0 - C- -4RZ2 - ? -
11 PsiBlast_PDB 63.9131% -34 - C2 -4RZ3 3.3 ?
28 PsiBlast_CBE 62.8931% -33 - C2 -4RZ3 8.4 ?
7 PsiBlast_PDB 62.7029% -39 - C2 -1G3Q - ? -
140 HHSearch 61.6530% -34 - C2 -1G3Q 8.8 ?