@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu33710: (2016-07-26 )
MKRKYLKLMIGLALAATLTLSGCSLPGLSAAADQTIKIGAQSMSESEIIASMLGQLIEHHTDLKTTTIKNLGSNAVQQQALMNGEIDIAATRYTGDALTGTLRMEPEKDPDKALALTQREFKKRYDLKWYDSYGFDNTYAFTVSKELADQYHLETVSDVKKWAPQLKLGVDNYWMKLKGNGYQDFTKTYGMTFGGTYPMQIGLVYDAVKSGKMDIVLAYSTDGRIKSYGLKMLKDDKQFFPPYDCSPVVPEKVLKEHPELEGIIKKMLGKIDTATMQELNYEVDGNLKEPSVVAKEYLEKHRYFES

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DCK_B_4(3PPO)
OPUCC_BACSU
[Raw transfer]




BET_A_3(3PPP)
OPUCC_BACSU
[Raw transfer]




BET_B_4(3PPP)
OPUCC_BACSU
[Raw transfer]




4CS_B_4(3PPR)
OPUCC_BACSU
[Raw transfer]




DCK_A_3(3PPO)
OPUCC_BACSU
[Raw transfer]




4CS_A_3(3PPR)
OPUCC_BACSU
[Raw transfer]




PGE_A_3(3O66)
?
[Raw transfer]




PGE_A_3(3O66)
?
[Raw transfer]




1 PsiBlast_PDB 96.48100% -76 - C4 -3R6U - OPUBC_BACSU -
2 PsiBlast_PDB 87.3570% -71 - C4 -3PPN - OPUCC_BACSU -
21 PsiBlast_CBE 86.3370% -75 - C4 -3PPR 3.2 OPUCC_BACSU
4 PsiBlast_PDB 86.2270% -72 - C4 -3PPP 2.8 OPUCC_BACSU
3 PsiBlast_PDB 85.9770% -70 - C4 -3PPO 2.8 OPUCC_BACSU
6 PsiBlast_PDB 85.9070% -73 - C4 -3PPR 3.3 OPUCC_BACSU
5 PsiBlast_PDB 85.8770% -76 - C4 -3PPQ - OPUCC_BACSU -
23 PsiBlast_CBE 85.7970% -73 - C4 -3PPP 2.7 OPUCC_BACSU
24 PsiBlast_CBE 85.6470% -72 - C4 -3PPO 2.7 OPUCC_BACSU
22 PsiBlast_CBE 85.4970% -72 - C4 -3PPQ - OPUCC_BACSU -
32 HHSearch 76.6895% 48 - C4 -3R6U - OPUBC_BACSU -
31 HHSearch 64.4653% 44 - C4 -3O66 2.1 ?
7 PsiBlast_PDB 63.7253% 69 - C4 -3O66 2.1 ?
8 PsiBlast_PDB 57.7028% 37 - C4 -1SW2 - ? -
45 Fugue 57.4229% 50 - C4 -1SW5 - ? -
12 PsiBlast_PDB 57.4127% 44 - C4 -1SW1 - ? -
9 PsiBlast_PDB 57.3428% 44 - C4 -1SW4 - ? -
15 PsiBlast_PDB 57.3324% 26 - C- -4WEP - YEHZ_ECOLI -
25 HHSearch 56.9729% 49 - C4 -1SW5 - ? -
10 PsiBlast_PDB 56.9728% 44 - C4 -1SW5 - ? -