@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu35670: (2016-07-30 )
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVEAGIEDIIIVTGKSKRAIEDHFDYSPELERNLEEKGKTELLEKVKKASNLADIHYIRQKEPKGLGHAVWCARNFIGDEPFAVLLGDDIVQAETPGLRQLMDEYEKTLSSIIGVQQVPEEETHRYGIIDPLTSEGRRYQVKNFVEKPPKGTAPSNLAILGRYVFTPEIFMYLEEQQVGAGGEIQLTDAIQKLNEIQRVFAYDFEGKRYDVGEKLGFITTTLEFAMQDKELRDQLVPFMEGLLNKEEI

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GUD_A_13(2PA4)
?
[Raw transfer]




GUD_C_15(2PA4)
?
[Raw transfer]




GUD_B_14(2PA4)
?
[Raw transfer]




GUD_D_16(2PA4)
?
[Raw transfer]




GUD_A_13(2PA4)
?
[Raw transfer]




UPG_A_2(5I1F)
?
[Raw transfer]




UPG_C_13(3JUK)
?
[Raw transfer]




UPG_B_9(3JUK)
?
[Raw transfer]




UPG_A_2(5I1F)
?
[Raw transfer]




UPG_A_5(3JUK)
?
[Raw transfer]




UPG_A_5(3JUK)
?
[Raw transfer]




UPG_D_17(3JUK)
?
[Raw transfer]




TTP_E_5(2GGQ)
?
[Raw transfer]




TMP_A_6(1H5S)
RMLA1_ECOLI
[Raw transfer]




G1P_A_5(1H5R)
RMLA1_ECOLI
[Raw transfer]




THM_A_5(5IDT)
?
[Raw transfer]




GOL_A_3(3PNN)
?
[Raw transfer]




POP_A_2(4G3Q)
GLMU_MYCTU
[Raw transfer]




57 HHSearch 83.0251% -34 - C1 -5I1F 6.5 ?
22 PsiBlast_CBE 81.6653% 3 - C1 -2UX8 - ? -
23 PsiBlast_CBE 79.9453% 3 - C1 -2UX8 - ? -
24 PsiBlast_CBE 79.7353% 2 - C1 -2UX8 - ? -
27 PsiBlast_CBE 78.8553% -2 - C1 -2UX8 - ? -
25 PsiBlast_CBE 78.4753% 0 - C1 -2UX8 - ? -
1 PsiBlast_PDB 78.2852% 2 * C1 *5I1F 6.5 ?
26 PsiBlast_CBE 77.6153% 5 - C1 -2UX8 - ? -
53 HHSearch 75.5138% -25 - C1 -2PA4 6.8 ?
59 HHSearch 74.3945% -33 - C1 -3JUK 7.7 ?
2 PsiBlast_PDB 73.2546% -28 - C1 -3JUJ - ? -
32 PsiBlast_CBE 72.7338% -15 - C1 -2PA4 6.4 ?
21 PsiBlast_CBE 72.7153% -19 - C1 -2UX8 - ? -
4 PsiBlast_PDB 72.7138% -15 - C1 -2PA4 6.8 ?
33 PsiBlast_CBE 71.7838% -15 - C1 -2PA4 5.9 ?
3 PsiBlast_PDB 71.1846% -31 - C1 -3JUK 7.7 ?
29 PsiBlast_CBE 71.1246% -29 - C1 -3JUK 8.2 ?
28 PsiBlast_CBE 70.8846% -24 - C1 -3JUK 8.0 ?
31 PsiBlast_CBE 70.7338% -14 - C1 -2PA4 6.9 ?
30 PsiBlast_CBE 69.5246% -29 - C1 -3JUK 7.6 ?
8 PsiBlast_PDB 52.2030% -71 - C1 -1H5R 4.2 RMLA1_ECOLI
6 PsiBlast_PDB 51.8030% -76 - C1 -1H5S 3.6 RMLA1_ECOLI