@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA0650: (2016-01-13 )
MDIKGALNRIVNQLDLTTEEMQAVMRQIMTGQCTDAQIGAFLMGMRMKSETIDEIVGAVAVMRELADGVQLPTLKHVVDVVGTGGDGANIFNVSSAASFVVAAAGGKVAKHGNRAVSGKSGSADLLEAAGIYLELTSEQVARCIDTVGVGFMFAQVHHKAMKYAAGPRRELGLRTLFNMLGPLTNPAGVRHQVVGVFTQELCKPLAEVLKRLGSEHVLVVHSRDGLDEFSLAAATHIAELKDGEVREYEVRPEDFGIKSQTLMGLEVDSPQASLELIRDALGRRKTEAGQKAAELIVMNAGPALYAADLATSLHEGIQLAHDALHTGLAREKMDELVAFTAVYREENAQ

Atome Classification :

(42 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

644_B_7(4M0R)
TRPD_MYCTO
[Raw transfer]




6M1_A_5(4N93)
TRPD_MYCTU
[Raw transfer]




644_A_3(4M0R)
TRPD_MYCTO
[Raw transfer]




6M1_B_13(4N93)
TRPD_MYCTU
[Raw transfer]




6F0_A_7(4OWO)
TRPD_MYCTU
[Raw transfer]




636_A_6(4GIU)
TRPD_MYCTU
[Raw transfer]




6F0_B_14(4OWO)
TRPD_MYCTU
[Raw transfer]




PRP_B_9(3QQS)
TRPD_MYCTU
[Raw transfer]




FA0_B_14(4N5V)
TRPD_MYCTU
[Raw transfer]




PRP_A_3(4N5V)
TRPD_MYCTU
[Raw transfer]




FA0_A_6(4N5V)
TRPD_MYCTU
[Raw transfer]




GOL_C_12(2ELC)
TRPD_THET8
[Raw transfer]




PRP_A_3(3QSA)
TRPD_MYCTU
[Raw transfer]




PRP_A_5(4OWM)
TRPD_MYCTU
[Raw transfer]




GOL_D_13(2ELC)
TRPD_THET8
[Raw transfer]




PRP_A_3(3R88)
TRPD_MYCTU
[Raw transfer]




PRP_A_7(4N93)
TRPD_MYCTU
[Raw transfer]




PRP_B_7(3QSA)
TRPD_MYCTU
[Raw transfer]




5RG_B_14(4OWN)
TRPD_MYCTU
[Raw transfer]




GOL_A_9(2ELC)
TRPD_THET8
[Raw transfer]




PRP_A_5(4OWU)
TRPD_MYCTU
[Raw transfer]




GOL_A_9(2ELC)
TRPD_THET8
[Raw transfer]




GOL_C_11(2ELC)
TRPD_THET8
[Raw transfer]




PRP_C_14(3UU1)
TRPD_MYCTU
[Raw transfer]




PRP_A_3(3R6C)
TRPD_MYCTU
[Raw transfer]




PRP_B_12(4OWO)
TRPD_MYCTU
[Raw transfer]




PRP_B_8(3R6C)
TRPD_MYCTU
[Raw transfer]




PRP_A_5(3QQS)
TRPD_MYCTU
[Raw transfer]




683_B_14(4GKM)
TRPD_MYCTU
[Raw transfer]




17C_A_8(3QQS)
TRPD_MYCTU
[Raw transfer]




17C_B_12(3QQS)
TRPD_MYCTU
[Raw transfer]




PRP_B_7(3R88)
TRPD_MYCTU
[Raw transfer]




PRP_A_3(4GIU)
TRPD_MYCTU
[Raw transfer]




PRP_B_12(4OWU)
TRPD_MYCTU
[Raw transfer]




PRP_C_13(3QQS)
TRPD_MYCTU
[Raw transfer]




683_A_6(4GKM)
TRPD_MYCTU
[Raw transfer]




PRP_B_10(4N5V)
TRPD_MYCTU
[Raw transfer]




PRP_A_5(4OWQ)
TRPD_MYCTU
[Raw transfer]




PRP_B_9(4N93)
TRPD_MYCTU
[Raw transfer]




14B_C_18(3UU1)
TRPD_MYCTU
[Raw transfer]




PRP_B_10(4OWM)
TRPD_MYCTU
[Raw transfer]




PRP_A_5(4OWO)
TRPD_MYCTU
[Raw transfer]




PRP_B_11(4GKM)
TRPD_MYCTU
[Raw transfer]




PRP_A_3(4GKM)
TRPD_MYCTU
[Raw transfer]




PRP_B_12(4OWN)
TRPD_MYCTU
[Raw transfer]




17N_A_6(3R6C)
TRPD_MYCTU
[Raw transfer]




PRP_B_6(3GBR)
TRPD_SULSO
[Raw transfer]




POP_A_3(4OWS)
TRPD_MYCTU
[Raw transfer]




FA0_B_4(4N8Q)
TRPD_MYCTU
[Raw transfer]




FA0_A_3(4N8Q)
TRPD_MYCTU
[Raw transfer]




BE2_B_4(4OWV)
TRPD_MYCTU
[Raw transfer]




1 PsiBlast_PDB 96.3159%-114 - C11 -4YI7 - ? -
2 PsiBlast_PDB 88.0447%-114 - C11 -4HKM - TRPD_XANCP -
105 HHSearch 86.4341% -96 * C11 *2ELC 2.4 TRPD_THET8
44 PsiBlast_CBE 85.4039%-100 - C11 -4OWN 4.1 TRPD_MYCTU
15 PsiBlast_PDB 85.0939% -95 - C11 -4GIU 6.5 TRPD_MYCTU
102 HHSearch 84.8034% -94 - C11 -1VQU - TRPD2_NOSS1 -
18 PsiBlast_PDB 84.8039% -96 - C11 -4OWQ 5.6 TRPD_MYCTU
45 PsiBlast_CBE 84.7839% -99 - C11 -4OWM 5.0 TRPD_MYCTU
50 PsiBlast_CBE 84.7739% -97 - C11 -3TWP - TRPD_MYCTU -
68 PsiBlast_CBE 84.7439% -96 - C11 -3QQS 5.7 TRPD_MYCTU
56 PsiBlast_CBE 84.6939% -99 - C11 -3R6C 5.9 TRPD_MYCTU
66 PsiBlast_CBE 84.6739% -96 - C11 -3QQS 3.0 TRPD_MYCTU
65 PsiBlast_CBE 84.6539% -97 - C11 -3QR9 - TRPD_MYCTU -
61 PsiBlast_CBE 84.6539% -97 - C11 -3QS8 - TRPD_MYCTU -
71 PsiBlast_CBE 84.6439% -97 - C11 -4GKM 5.9 TRPD_MYCTU
57 PsiBlast_CBE 84.5939% -97 - C11 -3R6C 5.8 TRPD_MYCTU
20 PsiBlast_PDB 84.4839% -97 - C11 -4OWU 6.2 TRPD_MYCTU
49 PsiBlast_CBE 84.4539%-100 - C11 -3UU1 5.1 TRPD_MYCTU
42 PsiBlast_CBE 84.4339% -95 - C11 -4OWU 6.4 TRPD_MYCTU
16 PsiBlast_PDB 84.4239% -95 - C11 -4OWM 5.9 TRPD_MYCTU
58 PsiBlast_CBE 84.3739% -96 - C11 -3QSA 6.1 TRPD_MYCTU
72 PsiBlast_CBE 84.2439% -96 - C11 -4GKM 5.7 TRPD_MYCTU
13 PsiBlast_PDB 84.2339% -93 - C11 -4N8Q 2.5 TRPD_MYCTU
43 PsiBlast_CBE 84.1439% -96 - C11 -4OWO 6.5 TRPD_MYCTU
55 PsiBlast_CBE 84.1139% -99 - C11 -3R88 5.9 TRPD_MYCTU
17 PsiBlast_PDB 84.1039% -96 - C11 -4OWO 6.1 TRPD_MYCTU
54 PsiBlast_CBE 84.0939% -99 - C11 -3R88 6.5 TRPD_MYCTU
67 PsiBlast_CBE 84.0339% -96 - C11 -3QQS 5.6 TRPD_MYCTU
41 PsiBlast_CBE 84.0239% -97 - C11 -4OWV 2.2 TRPD_MYCTU
12 PsiBlast_PDB 83.9839% -97 - C11 -4N5V 6.4 TRPD_MYCTU
59 PsiBlast_CBE 83.8139% -96 - C11 -3QSA 6.5 TRPD_MYCTU
69 PsiBlast_CBE 83.7539% -96 - C11 -4M0R 7.0 TRPD_MYCTO
39 PsiBlast_CBE 83.7139% -99 - C11 -4N8Q 3.2 TRPD_MYCTU
34 PsiBlast_CBE 83.4934% -99 - C11 -3GBR 3.3 TRPD_SULSO
40 PsiBlast_CBE 83.4439% -98 - C11 -4N5V 6.2 TRPD_MYCTU
14 PsiBlast_PDB 83.3739% -95 - C11 -4N93 5.9 TRPD_MYCTU
38 PsiBlast_CBE 83.3139% -98 - C11 -4N93 6.1 TRPD_MYCTU
70 PsiBlast_CBE 83.1439% -96 - C11 -4M0R 6.2 TRPD_MYCTO
35 PsiBlast_CBE 82.7641% -97 - C11 -2ELC 3.6 TRPD_THET8
19 PsiBlast_PDB 82.5639%-102 - C11 -4OWS 2.7 TRPD_MYCTU
11 PsiBlast_PDB 82.2341% -97 - C11 -2ELC 2.4 TRPD_THET8
36 PsiBlast_CBE 81.9441% -95 - C11 -2ELC 3.6 TRPD_THET8