@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA3376: (2016-02-16 )
MNAVCESIDASLDARDRPLLSVRGLTRLYGPEKGCQEVDFDLYPGEVLGIVGESGSGKSTLLSLLSGRCPPDAGTVAYRDDGDRWLDLYAASEAERRTLLRTEWGFVEQNPRDGLRMGVSAGANIGERLMAQGVRHYGRLRQAGLDWLEQVEIDPLRIDDLPRTFSGGMQQRLQIARNLVSAPRLVFMDEPTGGLDVSVQARLLDLLRGLVRELDLAVVIVTHDLAVARLLADRLMVMRRSRVVEAGLTDQILDDPQHPYTQLLVSSVLQP

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ANP_J_5(3C41)
?
[Raw transfer]




ATP_B_3(4FWI)
?
[Raw transfer]




ADP_A_2(4U00)
?
[Raw transfer]




ADP_A_3(1F3O)
Y796_METJA
[Raw transfer]




3 PsiBlast_PDB 85.0732%-109 - C2 -4U02 - ? -
53 Fugue 85.0525%-114 - C2 -3TUZ - METN_ECOLI -
1 PsiBlast_PDB 85.0433%-109 - C2 -4FWI 4.7 ?
41 HHSearch 83.8927%-106 - C2 -1B0U - HISP_SALTY -
23 PsiBlast_CBE 83.2132%-109 - C2 -4U02 - ? -
2 PsiBlast_PDB 83.0932%-110 - C2 -4U00 6.3 ?
35 HHSearch 82.6827%-111 - C2 -2IT1 - ? -
22 PsiBlast_CBE 82.4732%-112 - C2 -4U02 - ? -
37 HHSearch 82.1929%-113 - C2 -2YYZ - ? -
4 PsiBlast_PDB 81.7831%-107 - C2 -2YYZ - ? -
18 PsiBlast_PDB 81.6425%-115 - C2 -3TUZ - METN_ECOLI -
21 PsiBlast_CBE 81.1432%-107 - C2 -4U02 - ? -
5 PsiBlast_PDB 80.9833%-122 - C2 -4G1U - HMUV_YERPE -
58 Fugue 80.9424%-112 - C2 -1Z47 - ? -
20 PsiBlast_PDB 80.1827%-111 - C2 -4YMT - ? -
11 PsiBlast_PDB 79.8529%-113 - C2 -3C4J - ? -
13 PsiBlast_PDB 79.7827%-107 - C2 -2IT1 - ? -
8 PsiBlast_PDB 79.3629%-113 - C2 -2OLK - ? -
17 PsiBlast_PDB 79.2225%-111 - C2 -3TUI - METN_ECOLI -
9 PsiBlast_PDB 78.9729%-111 - C2 -2OUK - ? -
15 PsiBlast_PDB 74.0330%-102 - C2 -1F3O 5.8 Y796_METJA