@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : A9KMG0_LACP7: (2019-01-26 )
MLKMRNLISNYELAKDLLKNWEYDEENLDEMLSYFRISSNAIYPFFYKKKICFLRIAPTDEKRKENIYGEIEFIQYLREHDFKALCPVPSKNGEFIRIVNTKWGEYYATVFEKVAGKPVEACEYSEKMYHEYGKTMGRMHRLSSGFKPIIKKWTHEDVLNEIETMLTLYHCSNKAKIELENLRVELAKLPKNHLSYGLIHYDFELDNVFYDEKTNTCSVIDFDDGMYHWYSTDIEQFLDSVSEEKGELEAEQVKIAFFEGYQSEYPIVEETKNSIPLMRRFINLYSYVRIHHCLSDSFTSEKEWMTELRVKLTNMLKSIEETW

Atome Classification :

(21 SA) -.........-10.-----------------......-.20..------.--.-....30.....-.-..-40..--.-.-...-.----------50-------....-.....60.-.-.-..-.-..70...-....-.-80.-..-......90........100-....---...110.......120---.-----.-..-...---------130.-......140.-------------------.------------..-----.-------------..150-----------.----------..--..----....160--..---...-.--------.------.----------170-----.-----------.--...----...--.---180.....--------.-----.------.---190-------..-.....--..200.......210...---.--.-....220.----...-----...230----------....-.-..240....------------.--------..------------.250--....-.....260------.--..------....270...-...-..--280.......290..-------.....300.......310.......320.--------------
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) -MLKMRNLIS-NYE-----------------LAKDLL-KNWEY------D--E-ENLDEMLSYFR-I-SS-NAIY--P-F-FYK-K----------K--------ICFL-RIAPTDEK-R-K-EN-I-YGEIEFI-QYLR-E-H-D-FK-ALCPVPSKNGEFIRIVNTK-WGEY---YATVFEKVAGKPVEAC---E-----Y-SE-KMY---------HEYG-KTMGRMHRLS-------------------S------------GF-----K-------------PII-------------K----------KW--TH----EDVLN-E--IE---TML-T--------L------Y----------H-------C-----------S--NKA----KIE--L---E-NLRVEL--------A-----K------L---P---------KN-HLSYG--LIHYDFELDNVFY--DEK---T--N-TCSVIDFD----DGM-----YHWYST----------DIEQ-F-LDSV-SEEK------------G--------EL------------EA----EQVK-IAFFEGYQ------S--EY------PIVEE-TKNS-IPL-MR--RFINLYSYVRIHHCL-------SDSFTSEKEWMTELRVKLTNMLKSIEETW--------------
46 HHSearch 85.3020% -5 - C3 - - 6EF6 ? A:[27-324] -----------DVT-----------------IAQQAL-THYDV------S--DNASL----RLLN-L-SE-NATY--L-V-EDG-E----------H--------QSIL-RVHRQDYH-Q-P-HE-I-ESELDWL-AALR-TDS-D-VT-VPTVVPARDGRRVVTVDPAD-VPR---HVVHFEMVGGAEPDEE---S-----L-TL-DDF---------QTLG-RITASLHEHS-------------------Q------------RW-----T-------------RPAGF-----------G----------RF--SWDW--EHCLG-D--TPRWGRWQ-D--------A------EGV--------GAS-----E-----------T--ALL----TRA--Q---D-LLHRKL--------E-----E------Y---G---------SG-PDRYG--LIHADLRLANLLV--DSS---TPQR-TITVIDFD----DCG-----FGWYFY----------DFGT-A-VSFI-EHD-----------------------P------------RL----GEWQ-ESWVAGYR------S--RR------ELPAA-DEAM-LPS-FV--FLRRLLLLAWMGSHT-------HS-----------------------------------------
1 PsiBlast_PDB 82.6822% -15 - C3 - - 6EF6 ? A:[27-301] -----------DVT-----------------IAQQAL-THYDV------S--D----NASLRLLN-L-SE-NATY--L-V-EDG-E----------H--------QSIL-RVHRQDYH-Q-P-HE-I-ESELDWL-AALRTD-S-D-VT-VPTVVPARDGRRVVTVDPA-D---VPRHVVHFEMVGGAEPDEE---S-----L-TL-DDF---------QTLG-RITASLHEHSQRWTRP-------------A------------GF-----GRFSWDWEHCLGDTPRW-------------G----------RW--QD----AEGVG-A--SE---TAL-L-------------------------------------------------TRA----QDL--L---H-RKLEEY--------G-----S------G---P---------DR----YG--LIHADLRLANLLV--DSS---TPQR-TITVIDFD----DCG-----FGWYFY----------D----F-GTAV-SFIE------------H--------DP------------RL----GEWQ-ESWVAGYR------SRREL------PAADE-A-----------------------------------------------------------------------------
49 HHSearch 79.9717% -65 - C3 - - 2Q83 COTI_BACSU A:[18-305] ---------K-LTE-----------------LAENVL-QGWDV------Q--A-EKI----DVIQ------ALVW--K-V-HTD-S----------G--------AVCL-KRIHRP-----E-KK-A-LFSIFAQ-DYLA-K-K-G-MN-VPGILPNKKGSLYSK-----HGSF---LFVVYDWIEGRPFEL----------T-VK-QDL---------EFIM-KGLADFHTAS-------------------V------------GY-----Q-------------PPNGVPIFT-------K----------LG--RW----PNHYT-K--RC---KQM-E--------T------WKLMAEAEKEDPFSQLYLQE-----------I--DGF----IED--G---L-RIKDRL--------LQSTYVP------WT--E---------QL-KKSPN--LCHQDYGTGNTLL--GEN------E-QIWVIDLD----TVS-----FDLPIR----------DLRK-M-IIPL-LDT-------------T--------GV------------WD----DETF-NVMLNAYE------S--RA------PLTEE-QKQV-MFI-DM--LF---------------------------------------------------------------
47 HHSearch 76.3220% 8 * C3 * - 2PPQ - KHSE_AGRFC A:[9-284] ------------ED-----------------ELRNFL-TQYDV------G--SLTSY----KGIAE-----NSNF--L-L-HTT-K----------D--------PLIL-TLYEK------K-ND-L-PFFLGLM-QHLA-A-K-G-LS-CPLPLPRKDGELLGE-----LSGR---PAALISFLEGMWLRK----------P-EA-KHC---------REVG-KALAAMHLAS-------------------E------------GF-----E-------------IKRPNAL---------S----------VD--GW----KVLWD-K--SE---ERA-D--------E------V------------------------------E--KGL----REE--I---R-PEIDYL--------A-----A------H---W---------PK-DLPAG--VIHADLFQDNVFF--LGD------E-LSGLIDFY----FAC-----NDLLAY----------DVSI-C-LNAW-CFEK------------D--------GA------------YN----VTKG-KALLEGYQ------S--VR------PLSEA-ELEA-LPL-LS--RGSALRFFLTRLYDW--------------------------------------------------
30 Fugue 70.7917% 21 - C3 - - 2Q83 COTI_BACSU A:[11-346] --LSAEDAKK-LTE-----------------LAENVL-QGWDV------Q--A-EKIDVI---------Q-ALVW--K-V-HTD-S----------G--------AVCL-KRI---HR-P-E-KK-A-LFSIFAQ-DYLA-K-K-GMN--VPGILPNKKGS----LYSK-HGSF---LFVVYDWIEGRP---F---E-----L-TV-KQD---------LEFIMKGLADFHTAS-------------------V------------GY-----Q-------------PPN-------------GVPIFTKLGRWPN--HY----TKRCK-QM-ET---WKLMAEAEKEDPFS------Q----------L-------Y-----------L--QEI----DGF--I---E-DGLRIK--------D-----R------L---LQSTYVPWTEQL-KKSPN--LCHQDYGTGNTLL--GEN------E-QIWVIDLD----TVS-----FDLPIR----------DLRKMI-IPLL-DTTG------------V--------WD------------DE----TFNVML---NAYE------S--RA------PLTEE-QKQVMFIDML-----FPYELYDVIREKY-------VRKSALPKEELESAFEYERIKANALRQLI--------------
32 Fugue 68.7612% -21 - C3 - - 1ZYL - SRKA_ECOLI A:[4-328] -SAFTFQTLH-PDT-----------------IMDALF-E---H------G--I-RVDSGLTPLNS-Y-EN-RVYQ--F-Q-DED-R----------R--------RFVV-KFYRPERW-T-A-DQ-I-LEEHQFA-LQLV-N-D-E-VP-VAAPVAFNGQTLLNH------QGF---YFAVFPSVGGRQFE-----A-----D-NI-DQM---------EAVG-RYLGRMHQTG-------------------R------------KQLFIHRP-------------TIG-------------L----------NE--YL----IEPRK-L--FE---DAT-L--------I------PS---------G-------L-----------K--AAF----LKA--T---D-ELIAAV--------T-----A------H---W---------RE-DFTVL--RLHGDCHAGNILW--RDG---------PMFVDLD----DAR-----NGPAVQ----------DLWM-L-LNG------------------D--------KA------------EQ----RMQL-ETIIEAYE------E--FS------EFDTA-EIGL-IEP-LR--AMRLVYYLAWLMRRW-------ADPAFPKNFPWLTGEDYWLRQTATFIEQAKVLQEPPLQLTPMY
45 Fugue 68.4514% 5 - C3 - - 3CSV ? A:[4-333] ---------S-RED-----------------EIRDFL-ATHGY------A--D-W--NRTPRYQR-L-RS-P-----------T-G----------A--------KAVLMDWSP---E-E-G-GD-T-QPFVDLA-QYLR-N-L-D-IS-APEIYAEEHARGLLLIEDL-GDAL---FTEVINNDPAQ-----------------EMPLY---------RAAV-DLLIHLHDAQ-------------------T------------PE-----L-------------A--------------------------RL--DP----ETLSEMT--RL---AFS-E--------Y------R----------Y-------A-----------ILGDAA----EDN--R---K-RFEHRF--------A-----Q------I---L---------SA-QLEGDMVFVHRDFHAQNLLW--LPEREGL--A-RVGVIDFQ----DAKLGHRAYDLVSLLQDARRDVPAQVEA-QMIDHY-IQAT------------G--------VD------------ES----HFRS-AYAVIAVQRNMRILG--IF------ARLSQ-RFGK-RHY-IE--FVPRVWAHFERGLAH-------PALASAAEEILNALPAPAPEVLERLRA----------------
50 HHSearch 67.2716% -5 - C3 - - 1ZYL - SRKA_ECOLI A:[11-287] --------LH-PDT-----------------IMDAL--FEHGI------R--VDSGL----TPLN-S-YE-NRVY--Q-F-QDEDR----------R--------RFVV-KFYRPERW-T-A-DQ-I-LEEHQFA-LQLV-N-D-E-VP-VAAPVAF-NGQTLLN-----HQGF---YFAVFPSVGGRQFEAD-----------NI-DQM---------EAVG-RYLGRMHQTG-------------------R------------KQ-----L-------------FIHR------------PTIG-------LN--EY----LIEPR-K--LF---EDA-T--------L------I----------P-------SGL---------K--AAF----LKA--T---D-ELIAAV--------T-----A------H---W---------RE-DFTVL--RLHGDCHAGNILW--RD---------GPMFVDLD----DAR-----NGPAVQ----------DLWM-L-LNGD-KA-------------------------------------EQ----RMQL-ETIIEAYE------E--FS------EFDTA-EIGL-IEP-LR--AMRLVYYLAWLMRRW-------AD-----------------------------------------
48 HHSearch 67.2713% -19 - C3 - - 4PDY ? A:[20-305] -----------APL-----------------IPQAVV-SKYDL------A--I-QQR----H-------A-DGNI--E-VWTDS-K----------GR-------RYAA-KRSSIA-----P-AH-C-RIMVQCL-RHAQ-E-Q-G-FTKFARFVTTSSNAPYVR-----HGDF---TYYVTEWVSGQPANF----------G-LP-EHV---------AQTA-YTLAQFHEAT-------------------R------------SF-----R-------------TDWK------------------------D--DVFGLFQARWR-D--LR---QMW-L--------G------A----------DRKR----EKDAFDQLLLSMR--DEL----HRD--A---A-ESLALF--------E-----DRDVIAYL---E---------AE-RSSGG--WCHLDVIPSNCLY--TPQ------H-QVVLIDFE----LAR-----PAPRAL----------DMAH-L-LRRS-LER----------------------GN------------WD----GHLA-YACFLHFD------A--VR------NIPKS-EYRA-VEA-IL--RFPYLP-----------------------------------------------------------
53 HHSearch 63.4213% 7 - C3 - - 4WH3 NAHK_BIFL2 A:[5-307] ------------NE-----------------VLFGIA-SHFALEG----A--V-TGI----EPYGDG-HI-NTTY--L-V-TTD-G----------P--------RYIL-QQMNTSIFPD-TVNL-M-RNVELVT-STLK-A-Q-G-KE-TLDIVPTTSGATWAE-----IDGG---AWRVYKFIEHTVSYNL---V-----P-NP-DVF---------REAG-SAFGDFQNFL-------------------S------------EF-----D-------------ASQLTE----------TIAH-------FH--DT----PHRFE-D--FK---AAL-AADKLG---R------A----------A-------ACQPE-------I--DFY----LSH--A---D-QYAVVM--------D-----G------L---R---------DG-SIPLR--VTHNDTKLNNILM--DATT--G--K-ARAIIDLD----TIM-----PGSMLF----------DFGD-S-IRFG-ASTA------------LEDEKDLSKVH------------FS----TELF-RAYTEGFV------GELRG------SITAR-EAEL-LPF-SG--NLLTMECGMRF------------------------------------------------------
2 PsiBlast_PDB 62.8027% -5 - C4 - - 2PPQ - KHSE_AGRFC A:[66-270] -----------------------------------------------------------------------------------------------------------------------------------LGLM-QHLA-A-K-G-LS-CPLPLPRKDGELL--------GE-----------LSGRPAALI---S-----F-LE-GMWLRKPEAKHCREVG-KALAAMHLAS-------------------E------------GF-----E---------------I-------------K----------R---------PNALS----VD---GWK-V--------L------W----------D-------K-----------S--EER----ADE--V---EKGLREEIRPEIDYLAA-----H------W---P---------KD--LPAG--VIHADLFQDNVFFLGDEL---S--G----LIDFY----FAC-----NDLLAY----------DVSI-C-LNAW-CFEKD-----------G--------AY------------NV----TKGK--ALLEGYQ------S--VR------PLSEA-ELEA-LPL-LS--R----------------------------------------------------------------
51 HHSearch 62.1814% 19 - C3 - - 4OCV ? A:[24-326] -----------TNE-----------------ALFDVA-SHFAL------EGTV-DSI----EPYGDG-HI-NTTY--L-V-TTD-G----------P--------RYIL-QRMNTGIFPD-T-VN-LMRNVELVT-STLK-A-Q-G-KE-TLDIVRTTSGDTWAE-----IDGG---AWRVYKFIEHTMSYNL---V-----P-NP-DVF---------REAG-RAFGDFQNFL-------------------S------------GF-----D-------------ANQ-------------LTETIAH----FH--DT----PHRFE-D--FK---KAL-A--------ADELGR-A----------A-------GCGPE-------I--EFY----LSH--A---D-QYAVVM--------D-----G------L---R---------DG-SIPLR--VTHNDTKLNNILM--DATT--G--K-ARAIIDLD----TIM-----PGSMLF----------DFGD-S-IRFG-ASTALEDERDLD----K--------VH------------FS----TELF-RAYTEGFV------GELRD------SITAR-EAEL-LPF-SG--NLLTMECGMR-------------------------------------------------------
33 Fugue 60.6211% -30 - C3 - - 3I1A ? A:[3-330] -----KQPIQ-AQQ-----------------LIELLK-VHYGI------D--I-HTAQFI-QGGA-D-TN-AFAY--Q-A-DSE-S----------K--------SYFI-KLKY--GY-H-D-EI-N-LSIIRLL-HDSG-I-K-E-II-FPIHTLEAKL------FQQ-LKHF---KIIAYPFIHAPNGFTQ---N-----L-TG-KQW---------KQLG-KVLRQIHETSVPISIQQQLRKEIYSPKWRE------------IV-----R-------------SFY-------------N----------QI--EF----DNSDD-K--LT---AAF-K--------S------F----------F-------N-----------Q--NSA----AIHRLV---D-TSEKLS--------K-----K------I---Q---------PD-LDKYV--LCHSDIHAGNVLV--GNE------E-SIYIIDWD----EPM-----LAPKER----------DLMF-I-GGGVGNVWN------------K--------PH------------EI----QYFY-EGY--GEI------N--VD------KTILS-YYRH-ERI-VE--DIAVYGQDLLSRNQN-------NQSRLESFKYFKE-MFDPNNVVEIAFATE--------------
39 Fugue 60.2614% 38 - C3 - - 4OCV ? A:[24-378] TNEALFDVAS-HFA-----------------LEGTVD-SIEPY------G--D-GHIN---TTYL-V-TT-DG------------P----------R--------YILQ-RMNTGIFP-D-T-VN-L-MRNVELVTSTLK-A-Q-G-KE-TLDIVRTTSGDTWAEIDGG-AWRV---YKFIEHTMSYNLVP-------------NP-DVF---------REAG-RAFGDFQNFL-------------------S------------GFDANQLT-------------ETI-------------A----------HFH-DT----PHRFE-D--FK---KAL-AADELGR--A------A----------G-------C-----------G--PEI----EFY--LSHAD-QYAVVM--------D-----G------L---R---------DG-SIPLR--VTHNDTKLNNILM--DAT---T--GKARAIIDLDTIMPGSM-----LFDFGD----------SIRF-G-ASTA-LEDE------------R--------DL------------DKVHFSTELF-RAYTEGFV------G--ELRD----SITAR-EAEL-LPF-SG--NLLTMECGMRFLADYLEGDVYFATKYPEHNLVRSRTQIKLVREMEQRADETRAIVADVMETT---
52 HHSearch 56.4213% -1 - C3 - - 3I1A ? B:[6-291] --------IQ-AQQ-----------------LIELLK-VHYGI------D--I-HTA----QFIQGG-AD-TNAFAYQ-A-DSE-S----------K--------SYFI-KLKYGY-----H----D-EINLSII-RLLH-D-S-G-IKEIIFPIHTLEAKLFQQ-----LKHF---KIIAYPFIHAPNGFTQ---N-----L-TG-KQW---------KQLG-KVLRQIHETS-------------------V------------PI-----S-------------IQQQLRKEI-------Y----------SP--KW----REIVR-S--FY---NQI-E--------FDNSDDKL----------T-------AA----------F--KSFFNQNSAA--I---H-RLVDTS--------EKLSK-K------I---Q---------PD-LDKYV--LCHSDIHAGNVLV--GNE------E-SIYIIDWD----EPM-----LAPKER----------DLMF-I-GGGV-GNV------------------------------------WNK---PHEI-QYFYEGYG------E--IN------V-----DKTI-LSY-YR--HERIVEDIAV-------------------------------------------------------
63 HHSearch 55.6616% 3 - C3 - - 3C5I ? D:[11-293] -------LTD-PLY-----------------IKKICL-EKVPEWNHFTED--N-LRV----KQIL---LT-NQLF--E-V-GLK-EETANNYNSIRT--------RVLF-RIYGKHVD-E-L-YN-T-ISEFEVY-KTMS-K-Y-K-I--APQLLNTF---------------N---GGRIEEWLYGDPLRID---DL----K-NP-TIL---------IGIA-NVLGKFHTLS-------------------R------------KR-----H-------------LPEHWDRTPCIFK---M----------ME--KW----KNQLF-K--YK---NIE-K--------Y------N----------C-------D-----------I--HKY----IKE--S---D-KFIKFM--------K-----V------YSKSD---------NL-ANTIV--FCHNDLQENNIIN--TN-------K-CLRLIDFE----YSG-----FNFLAT----------DIAN-F-FIET-SIDYSVSSYPFFEIDKK--------KY------------IS----YENR-KLFITAYL------S--NY------------------------------------------------------------------------------------------
71 SP3 53.6012% 18 - C3 - - 1NW1 - CKA2_CAEEL A:[32-426] ---GMKELLS-TMDLDTDANTIPELKERAHMLCARFLGGAWKT------V--P-LEHLRISRIKG-G-MS-NMLF--L-C-RLS-E----------VYPPIRNEPNKVL-LRVYFNPE-T-E-SH-L-VAESVIF-TLLS-E-R-H-L--GPKLYGIFSG------------------GRLEEYIPSRPLSCH---E-----ISLA-HMS---------TKIA-KRVAKVHQLE-------------------V------------PI-----W-------------KEP-------------D----------YLCEAL----QRWLK-Q--LT---GTV-D--------A------E----------H-------RFDLPEECGV--S--SVN----CLD--L---A-RELEFL--------R-----A------H---I---------SLSKSPVT--FCHNDLQEGNILL--PKR---------LVLIDFE----YAS-----YNYRAF----------DFAN-H-FIEW-TIDY------------D--------IDEAPFYKIQTENFPE----NDQM-LEFFLNYL------R--EQGNTRENELYKK-SEDL-VQE-TLPFVPVSHFFWGVWGLLQ-------VELSPVGFGFADYGRDRLSLYFKHKQLLKNLA-----------
58 HHSearch 53.1414% 6 - C3 - - 3CSV ? A:[8-280] -------------------------------EIRDFL-ATHGY------A--D-WNR----TP----------RY--QRL-RSP-TG---------A--------KAVL-MDWSPE---E-G-GD-T-QPFVDLA-QYLR-N-L-D-IS-APEIYAEEH-------------AR---GLLLIEDLGDALFTEV---INNDPAQ-EM-PLY---------RAAV-DLLIHLHDAQ-------------------T------------PE-----L-------------ARL-------------D----------PE--TL----SEMTR-LA-FS---EYR-Y--------A------I----------L-------G--------------DAA----EDN--R---K-RFEHRF--------A-----Q------I---LSA-------QL-EGDMV--FVHRDFHAQNLLW--LPEREGL--A-RVGVIDFQ----DAK-----LGHRAY----------DLVS-L-LQDA-RRD------------------------------------VP----AQVE-AQMIDHYI------Q--AT------GVDES-HFRSAYAV-IA--VQRNMRILGIFARL---------------------------------------------------
42 Fugue 51.4211% -24 - C3 - - 3JR1 ? A:[14-309] ----NLYFQGMWKS-----------------ISQVLA-EQF--------G--A-YYFIKHKEKLY-S-GEMNEIW--L-I-NDE-V----------Q--------TVFV-KINE---R-S-Y-RSMF-RAEADQL-ALLA-K-T-N-S----INVPL------VYGIGN-SQGH---SFLLLEALNKSKN--------------KQ-SSF---------TIFA-EKIAQLHQIQ-------------------GPDKYGLDFDTWLGP-----I-------------YQP-------------N----------DWQTSW----AKFFS-ENRIG---WQL-Q--------I------C----------K-------E-----------K--GLI----FGN--I---D-LIVQIV--------A-----D------TL--S---------KH-NPKPS--ILHGNLWIENCIQ--VD-------D-KIFVCNP--------------ACYWG----------DREC-D-IAFS-SLFE------------P------------------------------FP-TNFYQRYN------E--IY------PLEEG----------YL--ERKLIYQLYYLLNFS-------YRYYNKKQSYVSLTQKLINQILHK-------------------
62 HHSearch 51.1312% -3 - C3 - - 5IGI ? A:[11-279] -------------------------------QLYALA-ARHGL------K--LHGPL----TVNELG-LD-YRIV--I-A-TVDDG----------R--------RWVL-RIPRRAE--V-S-AK-V-EPEARVL-AMLK-N-RLP-FA-VPDWRVANAELVAY------PMLE---DSTA-VIQPGSSTPDWVVPQ-----D-SE-VFA---------ESFA-TALAALHAVP-------------------I------------SA-----A-------------VDAGMLIR--------T----------PT--QA----RQK------VA---DDV-D--------R------V----------R-------R-----------EF-VVN----DKR--L---H-RWQRWL--------D-----D------D---S---------SW-PDFSV--VVHGDLYVGHVLI--DNT---E--R-VSGMIDWS----EAR-----VDDPAI----------DMAA-H-LMVF-G--------------------------------------------EEGL-AKLLLTYE------A--AG------GRVWPRLAHH-IAE-RL--AFGAVTYAL--------------------------------------------------------
68 HHSearch 50.0915% -7 - C3 - - 3F7W ? A:[2-271] -----------VNS-----------------VAARVT-ELTGR------E--V-AAV----AERG-HSHR-WHLY--R-V-ELADG----------T--------PLFV-KALPDDAP-ALD-GL-F-RAEALGL-DWLG-R-SFG-SP-VPQVAGWD---------------D---RTLAMEWVDERPPT--------------P-EAA---------ERFG-HQLAAMHLAG-------------------A------------ES-----F-------------GATWDGYIGPLPMDNTP----------RS--TW----PEFYA-EQRIL---PYL-R--------R------A----------A-------DRGAL-------T--PGD----VRL--V---E-KVLDAL--------D-----H------L---A---------GD-PEPPA--RIHGDLWNGNVLW--QDD------G--AVVIDPA-----AH-----GGHREA----------DLAM-L-ALFG----------------------------------------------LPYL-DRVRDAYN------E--VA------PLAEG-WRAR-IPL-HQ--LHPLLVHVCLFG-----------------------------------------------------